KEGG   Brucella melitensis bv. 1 16M: BMEI0843Help
Entry
BMEI0843          CDS       T00072                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01130  Biosynthesis of antibiotics
bme01230  Biosynthesis of amino acids
Module
bme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMEI0843
Enzymes [BR:bme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BMEI0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AAL52024
UniProt: P66988
Position
I:complement(868430..869341)
Genome map
AA seq 303 aa AA seqDB search
MRKPYSPSTAAQPLRFCKRSLPFPTTSRPDRKDRAMSTDILRKIEAYKREEIAAAKARLA
LDELKARTRDQSAPRGFLKALEAKRAAGQFALIAEIKKASPSKGLIRPDFDPPALAKAYE
EGGAACLSVLTDTPSFQGAPEFLTAARQACSLPALRKDFLFDPYQVYEARSWGADCILII
MASVDDDLAKELEDTAFALGMDALIEVHDEAEMERALKLSSRLLGVNNRNLRSFEVNLAV
SERLAKMAPSDRLLVGESGIFTHEDCLRLEKSGIGTFLIGESLMRQHDVAAATRALLTGA
EKL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaagccgtacagtccatcgacagcggcgcagcccttgcggttttgcaaaaggtca
ttgccgtttccaacgacaagccggcctgacaggaaggatcgcgccatgtccaccgatatt
cttcgcaagatcgaagcctataagcgggaagaaatagccgccgccaaggcgcgtcttgcc
cttgatgaactgaaggcccggacgagggatcagtcagcgccgcgcggttttctgaaggca
cttgaggccaagcgcgccgccggtcaatttgcactgatcgcggagataaagaaagcaagc
ccgtccaaaggcttgatccgccccgatttcgacccgccagcgcttgcaaaggcttatgaa
gaaggcggtgcggcctgtctttccgtgctgaccgacacgccttcctttcagggcgcgccg
gaattcctcacggccgcacgccaggcttgcagcctgcccgcattgcgcaaggatttcctg
ttcgacccctatcaggtctatgaagcgcgtagctggggagcggattgcattctcatcatc
atggccagcgtcgatgacgatcttgcaaaagagctggaagacacggctttcgcactgggc
atggatgcgctgatcgaagtgcatgacgaagctgaaatggaacgcgccctgaagctttcc
tcgcgcctgctcggcgtcaacaatcgcaatctgcgcagcttcgaggtcaatctcgccgtt
tccgagcggcttgcgaaaatggctccgtccgaccgtctgctggttggcgaaagcggcatc
ttcacgcatgaggactgcctgcggcttgaaaagtccggcatcggcacttttctgataggc
gaaagccttatgcgacaacatgacgttgcggcagccacccgcgcgcttttgacgggtgcg
gaaaagctatga

DBGET integrated database retrieval system