KEGG   Brucella melitensis bv. 1 16M: BMEI0863Help
Entry
BMEI0863          CDS       T00072                                 

Definition
(GenBank) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase / 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
  KO
K12506  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00900  Terpenoid backbone biosynthesis
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMEI0863
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     BMEI0863
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     BMEI0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YgbB IspD NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAL52044
UniProt: Q8YHD8
Position
I:complement(889150..890322)
Genome map
AA seq 390 aa AA seqDB search
MAAGRGERAGQSAEGPKQYRLIGAEAVLARTLRAFTDCPLIGTIAVVIHPDDHALYRRAV
PEKHENVILVTGGPTRQESTRLGLLALKDEAPQYVLIHDGVRPFIGQDLLERIIANLTPD
NGVLPALAVSDTLKRAAADGMVETTISRTGLFAAQTPQAFPYAPILDAHEKAFAINRTDF
TDDAAIAEWQEIAVRIIEGSADNTKLTWAKDIEMADKRLRQDHAVFPDIRTGNGYDVHSF
EPGDHVTLCGVKIPHEAKLNGHSDADVALHALTDALLATRGAGDIGTHFPPSDPQWKGAA
SRIFIEHAAKIVREAGGRIANVDVTLISEAPKIGPHRAAMTQALCDMLGIAADRVSIKAT
TNEKLGFVGRREGIAAIATATVIYPGEVPE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggcggccggtcgcggcgagcgggcggggcaaagcgccgaggggccgaagcaatatcgg
ctcattggcgcagaggccgtgcttgcccgcactttgcgcgcttttaccgattgcccgctc
atcggcacaatcgccgtcgtcattcatcccgacgatcatgcgctttatcggcgcgctgtg
ccggagaagcatgagaacgtcatcctcgttaccggtggccccacccgacaggaatcgacc
cgcctcggtcttctggccttgaaggacgaagcgccgcaatatgtgttgatccatgatggc
gtgcgtcctttcatcggtcaggatttgctggaacgcatcattgcaaacctcacccctgat
aatggtgtgcttcccgccctcgccgtctccgacacgttgaaacgggcggcggcagacggc
atggtagagaccaccatttcccgtaccggcttgttcgcggcgcagacgccgcaagctttt
ccctatgcgccgatcttggacgcacatgagaaagccttcgcaatcaaccgcaccgacttt
accgacgatgccgccattgccgaatggcaggaaattgctgttcgcattatcgaaggttcg
gcggataatacaaagctcacctgggcaaaggatattgaaatggcagacaagcgcctgcgg
caggaccatgccgtatttcccgacattcgcacgggcaatggctatgatgttcattctttc
gagccgggtgatcatgtcacgctttgcggcgtgaaaatcccccatgaggcaaagctcaac
ggtcactccgatgccgatgtggcccttcatgcgctgaccgacgccctgctcgccacgcgc
ggtgcgggtgatattggcacacattttccgccatccgatccgcaatggaaaggagctgcc
tcacgcatcttcatcgaacatgcggccaaaatcgtccgcgaggcgggaggccggatcgcc
aatgtggacgtgacactcatcagtgaagcgccaaagatcggcccccatcgcgccgccatg
acacaagcactctgcgacatgctgggcatcgccgccgaccgggtttccatcaaggctacg
acgaacgaaaagcttggctttgtcggccgtcgcgaaggcattgcagccatcgcaaccgca
accgtcatctaccccggagaagtaccggaatga

DBGET integrated database retrieval system