KEGG   Brucella melitensis bv. 1 16M: BMEI1076
Entry
BMEI1076          CDS       T00072                                 

Definition
(GenBank) protein translocase subunit secd / protein translocase subunit secf
  KO
K12257  SecD/SecF fusion protein
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme02024  Quorum sensing
bme03060  Protein export
bme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BMEI1076
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMEI1076
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMEI1076
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bme02044]
    BMEI1076
Secretion system [BR:bme02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BMEI1076
SSDB
Motif
Pfam: SecD_SecF Sec_GG ACR_tran MMPL SecD-TM1
Other DBs
NCBI-ProteinID: AAL52257
UniProt: Q8YGT1
Position
I:complement(1119540..1121867)
AA seq 775 aa
MGELRQCFIQAETDLHSMLYFSRWKSALIWLAVLVSLIIASPNFLSRETLANLPDFLPKK
QVSLGLDLSGGSRLILQVQNAGKTDLETTANIMRQRLEELGYGNPVVEGEGRNQIRVEVP
GLYDAQLLKDILTIRGNLSFRAMDDTMSPDDAIRGTPLADSEIVYSFDDPPVGYLLKKTP
ILTGHDITDAKASISADDGQPVITLTLDDNGRRRLADLTAQGNENSFAIVVDNQVVSAPT
VSGPLDTSELQIEGAFDLQAANNMAVVLRSGALPQAVTVLEERTIASALGEDYASAAVLA
ALLAALVVGLFMVLSYGILGVIALVALVVNIIILTAVLSLIGASISLASIAGLVLTIGLA
VDAHILIYERVREDRRKGYSVVQAMESGFYRALSTIVDANLTTLIAALVLFLLGSGTVHG
FALTVAIGIGTTLFTTLTFTRLLIAQWVRTAKPKEVPKRRLKLVPTVTHIPFMRLQFVTL
GISVLACAIVVALFVNIGFNYGIDFRGGSMVELQARNGDANLEDINERLAELNIDSARVL
PAKSPRSALVIIGSQEVGDDAEQTVAVKLRGEFEQDYSFQRVDVVGPTVSEQLSRAGVLA
VILSLIGIFIYVWFRFRWQLALGAVLSTLHDVVILSGMFIVFRMEFNLWSVAAILTIIGY
SLNDTVVIYDRVRENLRRYKSAPLPAIIDASINQTLSRTLLTSFVTFLAHVPLYAFGGSE
IRMFALALSVGIIVASYSSIFIAAPLLVQFGLKPRETDAGDAVDAELAQSLNLES
NT seq 2328 nt   +upstreamnt  +downstreamnt
ttgggtgaactccggcaatgcttcatccaagctgaaacggacttgcattccatgctctat
ttttcacgctggaaatctgcactgatatggctggcagtccttgtcagcctcatcatcgca
tctccaaattttctctcgcgtgaaacgctggcaaatctgccggattttctgcccaagaag
caggtatcgctggggctcgacctttcgggcggctcgcggcttattcttcaggtgcagaat
gcaggcaagaccgatctggagacgactgccaatatcatgcggcagcgtctggaagagctt
ggctatggcaatcccgttgtcgagggagaggggcgcaatcagattcgcgtggaggttccg
ggcctttacgatgcgcagcttctcaaagatattctcaccattcgcggaaatctttccttc
cgcgccatggacgacaccatgtcgccggatgacgccattcgcggcacaccgcttgccgat
agcgaaatcgtctattcctttgatgatcctccggttggttatcttctgaaaaaaacaccc
attctcaccgggcatgacatcacggatgccaaggcgagtatttccgccgacgatggccag
ccggtcatcacgctgacactggacgacaacggacgccggcgtctggccgatctgacggcg
cagggcaatgagaattccttcgccatcgtcgttgataatcaggtggtttccgcgcccacg
gtttccggcccgctcgacaccagtgaattgcagatcgaaggcgcattcgatttacaggcc
gccaataatatggccgtggttctgcgctctggcgccttgccgcaagcggtgactgtgctt
gaagagcgcaccatcgcctccgcgctcggtgaggattatgcgagtgcggcagtgcttgcg
gcccttctggcggcactggtggtcggcctcttcatggtgctttcctatggcattctgggt
gtcatcgccctggttgcgcttgtggtcaatatcatcatcctgacggctgttctgtcgctc
attggcgcttcgataagccttgcgagcattgcaggtctcgtcttgaccatcggccttgcg
gtcgatgcgcatattctgatctatgagcgtgtacgcgaggatcgccgcaagggctattcc
gtcgtgcaggcgatggaatcgggcttttatcgcgccctttccaccattgtggatgccaat
cttaccacgcttatcgccgcactcgttctgttccttctggggtcgggtacggtgcatggt
tttgcgctcacggtcgcaatcggcatcggcacgacgcttttcaccacgctcactttcacg
cgcctgctgatcgcccaatgggtgcgcaccgccaagccgaaggaagtgcccaagcgtcgc
ctgaaactggtgccaaccgtcactcatattcccttcatgcgcctccagttcgtaacgctc
ggcatttcggtgctggcctgcgcaatcgtggtcgcgcttttcgtcaatatcggcttcaac
tacggcatcgactttcgtggcggttcgatggtcgagctgcaggcgcgcaatggcgatgcc
aatctggaagatatcaacgagcggctcgcggagctgaatatcgatagcgcccgcgttctg
cctgcgaaatcgccgcgctcggcccttgtcattatcggcagtcaggaagtgggcgacgat
gcggagcagaccgttgccgtcaagcttcgcggtgaattcgagcaggattattccttccag
cgggtcgatgtggtcgggccgaccgtatcggaacaattgtcgcgcgcaggcgtgctcgct
gtcatcctgtcgctgattggcatcttcatctatgtctggttccgcttccgctggcagctc
gcactgggcgcggtgctttccacattgcatgatgtcgtcattctttcaggcatgttcatc
gttttccgcatggaattcaatttgtggagcgtggcggcaatcctcacgatcattggctat
tcgctgaacgatacggtggtgatctatgaccgggtgcgcgagaaccttcgccgttacaag
agtgcgccattgcccgcgatcatcgatgcctcgatcaaccagaccctgtcgcgaacgctg
ttgacctctttcgtcaccttcctggcacatgttccgctttatgcttttggcggctcggaa
attcgcatgtttgcgctggcgctcagtgtcggtatcattgtggcgagttattcttcaatc
ttcatcgcagcaccgctgcttgttcagttcggtctcaagccgcgcgaaaccgatgccggt
gacgcggtggatgcggagcttgcgcaatcgctcaatctggaaagctga

DBGET integrated database retrieval system