KEGG   Brucella melitensis bv. 1 16M: BMEI1768Help
Entry
BMEI1768          CDS       T00072                                 

Definition
(GenBank) uroporphyrin-iii c-methyltransferase / precorrin-2 oxidase / ferrochelatase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00860  Porphyrin and chlorophyll metabolism
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMEI1768
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BMEI1768
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BMEI1768
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BMEI1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: AAL52949
UniProt: Q8YEV9
Position
I:complement(1811432..1812859)
Genome map
AA seq 475 aa AA seqDB search
MSLSQTRLLADFPAFFRVSGEVVAVVGGGEEALNKARLVAQTAARLRIIAEKAEPHLAAF
IESHGVEHIASPFAPELLDGAKLVFVATGDEAGDRAAAAAARARKIPVNVVDRPALCDFL
TPAIVNRAPVTIAIGSQGTAPVLAQMVRARIDAAFSPRLGELAHFAESWRPLVERALPKG
LARRGFWRTFFSGKVARAVESGDHEAAHRAAAELIGQGQDASGHVWLVGAGPGAEDLLTL
RAQRVLMEADVIVHDALVPEGVIAMGRRDAERLPVGKRKGCHSKSQGEINRLLVKLGQEG
KRVVRLKSGDPLVFGRAGEEMAALRAAGIGFEVVPGITSAFAAAADMELPLTLRGVASSL
VFTTGHDMTGDVLPGWAKLAVSGATIAVYMGSTVAASVASRLIAAGLHEDTAVAVVENAS
RSNKRMFHGTLKDLPQLENRKELSGPVMVVIGDAVAGAAIGRAQALSLKPVPVAA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgtctttatcgcaaacgcgacttctggctgattttcctgctttcttccgggtttcgggc
gaagtggtggcggtcgtgggtggtggcgaggaagccttgaacaaggctcgcctcgtggcg
cagacggctgcgcgcctgcgcatcattgctgaaaaggctgagccgcatcttgccgctttt
attgaaagccatggggtggagcatattgcgtcaccctttgcgccggaactgctggatggt
gcgaagctcgtttttgtcgcgaccggcgatgaggccggggatcgtgccgccgctgccgcc
gcaagggcccgcaaaattccggtcaatgtggtggaccgtcccgccctttgcgattttctg
acacctgccatcgtcaatcgtgcgccggtcacgatcgccatcggttcgcagggaaccgcc
ccggttttggcgcagatggtgcgtgcgcgtatcgatgcagccttttcgccgcgtcttggc
gagcttgcgcattttgcggaaagctggcgccctctggtcgagcgggcgcttccaaaaggg
cttgcgcggcgtggtttctggcgcacattcttttcgggaaaagtggcccgcgcggtggag
agtggcgaccacgaggcggcgcacagggctgcggcggaactgatcgggcaggggcaggac
gcttccggccatgtctggctggttggggccggtcccggtgctgaagaccttttgacgctg
cgcgcccagcgcgtgctgatggaagccgatgtgatcgttcatgatgcgctggtgccggaa
ggcgtcatcgccatgggacgccgcgacgccgagcgcctgccggtaggcaagcgcaagggt
tgccattccaaaagccagggtgagatcaaccgcctgctggtgaagctggggcaggagggc
aagcgcgtggtgcgcctgaaatccggcgatccgctggtctttggccgtgcgggtgaggaa
atggccgccttgcgcgccgccggaataggctttgaggtggtgccgggcatcacctctgcc
tttgccgctgccgccgatatggaactgccgctgaccttgcgcggcgtcgcgtcctcgctc
gtcttcaccacgggccatgacatgaccggcgatgtgctgcccggctgggcgaagcttgcc
gtctccggcgctacgattgccgtctatatgggctccacggttgccgcttccgttgcctcg
cgtctgattgccgccggcctgcatgaggatacggcggttgcagtggtggaaaatgcaagc
cgcagcaacaagcgcatgttccatggcacgctgaaggatttgccgcagcttgaaaaccgc
aaggagctttccggcccggtcatggtggtcattggcgatgccgtcgccggtgccgccatt
ggcagggcgcaggccctttccctgaaacctgttcccgtcgcagcctga

DBGET integrated database retrieval system