KEGG   Brucella melitensis bv. 1 16M: BMEI1772Help
Entry
BMEI1772          CDS       T00072                                 

Definition
(GenBank) nucleoside-triphosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BMEI1772
Enzymes [BR:bme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BMEI1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: AAL52953
UniProt: P64305
Position
I:complement(1815596..1816270)
Genome map
AA seq 224 aa AA seqDB search
MELKMRMLEKGKLIVASHNAGKLREFDGLIGPFGFEVSSVAALGLPEPDETGTTFEENAY
IKALAAAKATGFPALSDDSGLMVDALDGEPGVYTANWAETEDGKRDFDMAMQKVENLLQE
KGATTPDKRKARFVSVICLAWPDGEAEYFRGEVEGTLVWPPRGNIGFGYDPVFLPDGYGK
TFGEMTAEEKHGWKPGDASALSHRARAFKLFAEKALNVVSAPAE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtggaattgaaaatgagaatgctggaaaagggcaagctgatcgtcgcctcgcacaatgcg
ggcaagctcagggaatttgacgggttgatcggcccgttcggtttcgaggtgagttcggtc
gcggcccttggcctgccagaaccggacgagaccggcacgacctttgaggaaaacgcctat
atcaaggcgcttgccgccgccaaggcaacgggctttccagctttatccgacgattccggc
ctgatggtggacgcacttgacggcgaaccgggcgtctacacggccaactgggcggaaacg
gaagacggcaaacgcgatttcgacatggccatgcagaaggtggaaaatcttttgcaggaa
aagggcgcgacgacgcctgataaacgcaaggcgcgtttcgtctcggtcatctgccttgcc
tggcccgatggcgaggcggaatatttccgtggtgaagtggaaggcacgctcgtctggcca
ccgcgcggcaatatcggtttcggttacgatccggtgtttctgcccgatggatacgggaaa
accttcggcgaaatgacggcggaagaaaagcatggctggaagccgggtgacgccagcgcg
ctgtcgcaccgggcccgcgccttcaagctttttgccgaaaaggcactcaacgtggtatcg
gctccggcagaatga

DBGET integrated database retrieval system