KEGG   Brucella melitensis bv. 1 16M: BMEI1945Help
Entry
BMEI1945          CDS       T00072                                 

Definition
(GenBank) probable enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00071  Fatty acid degradation
bme00280  Valine, leucine and isoleucine degradation
bme00281  Geraniol degradation
bme00310  Lysine degradation
bme00360  Phenylalanine metabolism
bme00362  Benzoate degradation
bme00380  Tryptophan metabolism
bme00410  beta-Alanine metabolism
bme00627  Aminobenzoate degradation
bme00640  Propanoate metabolism
bme00650  Butanoate metabolism
bme00903  Limonene and pinene degradation
bme00930  Caprolactam degradation
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
bme01130  Biosynthesis of antibiotics
bme01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMEI1945
   00650 Butanoate metabolism
    BMEI1945
  Lipid metabolism
   00071 Fatty acid degradation
    BMEI1945
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMEI1945
   00310 Lysine degradation
    BMEI1945
   00360 Phenylalanine metabolism
    BMEI1945
   00380 Tryptophan metabolism
    BMEI1945
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMEI1945
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMEI1945
   00281 Geraniol degradation
    BMEI1945
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMEI1945
   00627 Aminobenzoate degradation
    BMEI1945
   00930 Caprolactam degradation
    BMEI1945
Enzymes [BR:bme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMEI1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AAL53126
UniProt: Q8YED3
Position
I:complement(2004160..2005041)
Genome map
AA seq 293 aa AA seqDB search
MPVQFAPRNFKAGQPCRHIIPDEPGCHALMKEERVYMAYETIIVETRDSVGLIRLNRPQA
LNALNRAVLEELTDALAAFDADGKVGAVVLTGSEKAFAAGADIKEMQLINFVDAYLQDMF
ADWQKVDRIRKPIIAAVSGYALGGGCELAMMCDFIIAGSNAKFGQPEITLGAIPGMGGSQ
RLTRYVGKSKAMDMCLTGRMMDAAEAERCGLVSRVVAPEALLEEALKAAERIASFSRVSV
YMAKEAVNRAYETTLDEGLRFERRLFHSLFATEDQKEGMSAFVDKRTPSFKNR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccaatttgcgccacggaattttaaggcggggcagccttgccggcacattatc
ccggatgagccgggctgtcacgcgctgatgaaggaggaacgggtttacatggcctatgaa
acaatcatcgttgagacgcgtgacagcgttggtctcatccgtctcaaccgtccgcaggcg
ctcaacgcgctcaatcgcgccgtgcttgaggagctgaccgatgcgcttgccgccttcgac
gcggatggcaaggtcggcgccgtggtgctgaccggctcggaaaaggctttcgccgccggg
gccgacatcaaggaaatgcagttgatcaatttcgtcgatgcctatttgcaggacatgttc
gccgactggcagaaggtggatcgtatccgcaagccgattatcgcggctgtttcgggctat
gcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatcgcgggcagcaat
gcgaaattcggccagccggaaatcacgctgggcgccattcctggcatgggcggctcgcag
cgcctgacgcgctatgtcggcaagtccaaggctatggatatgtgcctgacgggccgcatg
atggatgcagccgaagcggagcgttgcggccttgtttcccgcgttgtcgcaccggaggct
cttctggaagaggcactgaaagcagccgaacgcatcgcatccttctcgcgcgtctcggtc
tatatggccaaggaagcggtcaaccgcgcctatgaaacgacgctggacgagggcctgcgt
ttcgagcgccgcctgttccattcgcttttcgcgaccgaagaccagaaggaaggcatgtcc
gctttcgttgataaacgtaccccttccttcaagaaccgctga

DBGET integrated database retrieval system