KEGG   Brucella melitensis bv. 1 16M: BMEI1952Help
Entry
BMEI1952          CDS       T00072                                 

Definition
(GenBank) gluconate 2-dehydrogenase
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00630  Glyoxylate and dicarboxylate metabolism
bme01100  Metabolic pathways
bme01110  Biosynthesis of secondary metabolites
bme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMEI1952
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     BMEI1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 GFO_IDH_MocA Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AAL53133
UniProt: Q8YEC6
Position
I:complement(2009924..2011006)
Genome map
AA seq 360 aa AA seqDB search
MCRKLSGRPFGHCGGVLKAFSNDGVEMSNKKKPMVVLTRKLPDPVETRMRELFDARLNID
DHRMSQPEIIAALKEADVLVPCITDVIDAAVIEQAGPNLKLIANFGNGVDNIDVAAAARR
GITVTNTPNVLTEDTADMTLALLLSVPRRLVEGANVINERHGQWPGWSPTWMLGRRIWGK
RLGIVGMGRIGTAVARRAKAFGLSIHYHNRKRVSPQVEEELEATYWDSLDQMLARMDIIS
VNCPSTPATFHLLSARHIALMQPTAYLVNTARGQIIDENALIDLIEEGRLAGAGLDVFEH
EPAVNPRLLALAEKGKVVLLPHMGSATIEGRIDMGDKVIINIRAFVDGHRSPDRVLPNRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaggaaattatcgggacgtccgtttggtcattgtggcggcgttctgaaggcattc
tcaaatgacggggtggaaatgtcgaacaagaagaagccgatggtcgttcttacgagaaaa
ctgccggacccggtggaaacccgaatgagggaactgttcgatgcgcgtctgaacatagac
gatcaccgcatgagccagccggaaatcatcgctgccctgaaggaagctgatgttctggtg
ccctgcatcaccgatgtcatcgacgcagcggtcatcgaacaggcaggaccaaatctgaag
ctgatcgccaattttggcaacggcgtggataatatcgatgtagctgccgccgccaggcgc
ggcatcaccgtcaccaatacgcccaatgttctgaccgaagacactgccgacatgacgctg
gcgctgcttttgtcggtgccgcgccgcctcgtggaaggtgcaaatgtcatcaatgagcgc
catggccagtggccgggctggtcgcccacatggatgctcggacgccgcatctggggcaaa
cgtctcggcattgtgggcatggggcgcatcggaacggcggttgcccgccgcgccaaggcc
tttggcctctcgatccattatcacaatcgcaagcgcgtcagcccgcaggttgaggaagag
ctggaggcgacctattgggacagcctcgaccagatgctggcccgcatggacatcatctcg
gtcaattgcccgtccacgcccgcgaccttccacctgctttccgcccgccacattgcgctg
atgcagccgaccgcctatctggtcaacacggcgcgcggccagatcatcgatgaaaatgcg
ctgatcgaccttatcgaagagggcaggctggccggtgccgggctggatgtcttcgagcat
gagccagccgtcaatccgcgcctgctggcactggccgaaaagggcaaggtggtgcttctg
ccgcatatgggatcggccacgatagaaggccgtatcgatatgggcgacaaggtcatcatc
aatattcgtgccttcgtggacggccaccgttcgcccgatcgcgtgctgcccaaccgggtc
tga

DBGET integrated database retrieval system