KEGG   Brucella melitensis bv. 1 16M: BMEI1961Help
Entry
BMEI1961          CDS       T00072                                 

Definition
(GenBank) polyribonucleotide nucleotidyltransferase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00230  Purine metabolism
bme00240  Pyrimidine metabolism
bme03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BMEI1961
   00240 Pyrimidine metabolism
    BMEI1961
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BMEI1961
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bme03019]
    BMEI1961
   03016 Transfer RNA biogenesis [BR:bme03016]
    BMEI1961
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     BMEI1961
Messenger RNA biogenesis [BR:bme03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BMEI1961
Transfer RNA biogenesis [BR:bme03016]
 Prokaryotic Type
  tRNA degradation factors
   BMEI1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH PNPase RNase_PH_C S1 KH_1 Cauli_DNA-bind
Motif
Other DBs
NCBI-ProteinID: AAL53142
UniProt: Q8YEB7
Position
I:complement(2017425..2019569)
Genome map
AA seq 714 aa AA seqDB search
MFNTHKVEIEWGGRPLTLETGKIARQADGAVLATYGETAVLATVVSAKEPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFVDGYKNDTQVVITVLQH
DLENNPDILSMVAASAALTISGVPFMGPISGARVGYIDGEYVLNPNIDEMPESKLDLVVA
GTSEAVLMVESEAQELPEDVMLGAVMFGHKSFQPVIDAIIKLAEVAAKEPRDFQPEDLSE
LEAKVLAVVENDLREAYKITEKQARYAAVDAAKAKAEEHFFPEGVEETEMSAEQFATIFK
HLQAKIVRWNILDTGNRIDGRDLSTVRPIVSEVGILPRTHGSALFTRGETQAIVVATLGT
GEDEQMIDALTGTYKESFMLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIHPMLPAA
EQFPYTIRAVSEITESNGSSSMATVCGTSLALMDAGVPIVRPVAGIAMGLIKEGERFAVL
SDILGDEDHLGDMDFKVAGTEFGITSLQMDIKIDGITEEIMKVALEQAKGGRVHILGEMA
KAISSSRAELGEFAPRIEVMNIPTDKIRDVIGSGGKVIREIVEKTGAKINIEDDGTVKIA
SSNGKEIEAAKKWIHSIVAEPEVGEIYEGTVVKTADFGAFVNFFGPRDGLVHISQLAADR
VAKTTDVVKEGQKVWVKLMGFDERGKVRLSMKVVDQETGKEIVAEKKKEEVDAE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatacccataaagttgaaatcgaatggggcggacgtccgctcacactcgaaacc
ggcaagattgcccgtcaggctgacggcgctgttctcgccacctatggcgaaaccgccgtt
ctcgcaactgtcgtttctgccaaggaaccgaagccgggccaggacttcttcccgctgacc
gtcaattatcaggaaaagacctatgcagccggcaagattcccggcggctatttcaagcgt
gaaggccgtccgagcgaaaacgaaaccctcgtttcgcgcctgatcgaccgtccgatccgc
ccgcttttcgttgacggctacaagaacgacacgcaggtcgtcattaccgttctccagcac
gatctggaaaacaacccggacatcctgtcaatggttgcggcatctgccgccctcaccatt
tcgggcgtgcctttcatgggtccgatcagcggcgcgcgcgttggttatatcgatggcgaa
tatgtcctgaacccgaatatcgatgaaatgccggaatccaagctcgatctggtggttgcc
ggtacgtcggaagcggttctgatggtcgaatcggaagcgcaggaactgcccgaagatgtc
atgctcggcgccgtcatgtttggccacaagagcttccagccggtgatcgatgcgatcatc
aagcttgccgaagttgccgccaaggaaccgcgtgacttccagccggaagacctgtcggaa
ctggaagccaaggtgctggccgttgtggaaaacgacctgcgcgaagcttacaagatcact
gaaaagcaggcgcgctacgcagccgttgatgccgccaaggccaaagccgaggaacatttc
ttccccgaaggcgtggaagaaaccgaaatgtcggcggaacagttcgcgaccattttcaag
catctgcaggccaagatcgttcgctggaacattctcgacacgggcaaccgtatcgatggc
cgtgacctttcgaccgttcgtccgatcgtttcggaagtcggcatcctgccgcgcacccac
ggttccgcgctcttcacccgcggtgaaacgcaggccatcgtcgttgccacgctcggcacc
ggcgaagacgaacagatgatcgatgcgctgacgggaacctacaaggaatccttcatgctg
cattacaatttcccgccctattcggtcggtgaaacgggccgcatgggttctccgggccgc
cgcgaaatcggccatggcaagcttgcctggcgcgcaatccatccgatgctgcctgccgcc
gaacagttcccctatacgatccgcgctgtttccgaaatcacggaatcgaacggctcttcc
tcgatggcaaccgtttgcggcacctcgctggcgctgatggatgccggtgtgccgatcgtg
cgccccgtcgccggtatcgccatgggtctcatcaaggaaggcgaacgtttcgccgttctt
tccgacattctcggcgatgaagatcacctcggcgacatggacttcaaggtggccggtacc
gaattcggcatcacatcgctacagatggacatcaagatcgacggtatcaccgaagagatc
atgaaggtcgctctggaacaggcaaagggtggccgcgttcacattctcggcgaaatggcc
aaggccatctcctcctcgcgcgctgaactgggcgagtttgccccgcgcatcgaagtgatg
aacattccgaccgacaagatccgcgacgtgattggctccggcggcaaggttatccgcgag
atcgtggaaaagaccggcgccaagatcaacatcgaggacgatggtacggtcaagatcgcg
tcgtcgaacggcaaggaaatcgaagccgccaagaagtggattcactccattgtggctgaa
ccggaagtcggcgaaatctatgaaggcacggtcgtcaagaccgccgatttcggcgctttc
gtgaacttcttcggcccgcgtgacggtctggttcatatctcgcagctcgctgccgaccgt
gttgccaagaccaccgatgtggtcaaggaaggccagaaggtctgggtcaagctcatgggc
ttcgacgaacgcggcaaggttcgcctgtcgatgaaggtcgtcgatcaggaaaccggcaag
gaaatcgttgctgaaaagaagaaggaagaagttgacgctgaataa

DBGET integrated database retrieval system