KEGG   Brucella melitensis bv. 1 16M: BMEII0078Help
Entry
BMEII0078         CDS       T00072                                 

Definition
(GenBank) 2,3-dihydroxybenzoate-amp ligase
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme01053  Biosynthesis of siderophore group nonribosomal peptides
bme01110  Biosynthesis of secondary metabolites
bme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BMEII0078
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bme01008]
    BMEII0078
Enzymes [BR:bme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     BMEII0078
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     BMEII0078
Polyketide biosynthesis proteins [BR:bme01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    BMEII0078
   Bacillibactin synthetase
    BMEII0078
  Nonlinear NRPS
   Vibriobactin synthetase
    BMEII0078
   Myxochelin synthetase
    BMEII0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C GH3
Motif
Other DBs
NCBI-ProteinID: AAL53319
UniProt: Q8YDU6
Position
II:78252..80015
Genome map
AA seq 587 aa AA seqDB search
MAPCCVPAAFRPETEPLHVFVSTHYPTQSRFALRARKLHSFLFQAEQVMTIEFTHWPPAR
ERLYREKGYWIDKPLTRALEEQAAMRPDAPAILCGERRFTYAELDRLSSNLASRLAAAGI
GKGDTALVQLPNIAEFYIVFFALMKAGIAPVNALFSHRKLELGAYASQIEPRLLIGSRQH
ELFMDDAFARDLGKNLSAPLLTLFAGEADHASSLDHWIATPADKAVPFSPTGAGEVAFFQ
LSGGSTGTPKLIPRTHNDYDYSVRASAEICALTPQTRFLCALPTAHNYPMSSPGALGVFH
AGGCVVMAPNPEPLNCFSIIERHGVNMVALVPPAVALWLQAAPDHLAALSSLKLVQVGGA
SFAEALARQVPQVLGCKLQQVFGMAEGLVNYTRLDDPDEIVFTTQGRPISPDDEIRIVDE
DGEPVAEGQPGMLATRGPYTFCGYYRSPEHNAQVFDSEGFYYSGDVVQRTPEGYLRVVGR
VKDQINRGGEKVAAEEIENLILLHPDVTHAALVAMQDELLGEKSCAFIVSRNPDLKPPVL
RRHLLALGVAEYKLPDRIRLIETMPLTAVGKIDKKHLRKLSSPSSPG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
ttggcaccatgctgcgtgcctgcggcctttcggcctgaaacagagcctctccatgtcttt
gtttctacgcattatccgacgcagagccgcttcgcattgcgggctcgaaaactgcactcg
tttttatttcaagcagaacaagtcatgaccatcgaatttacccattggccaccggcacgc
gaacgcctctatcgcgaaaagggctactggatcgacaaacccctcacccgcgcactggaa
gaacaggccgccatgcggcccgatgcgcccgctatcctctgcggcgagcggcgtttcacc
tatgccgaactcgaccgtctgtcttccaacctggcctcccggcttgcggcagccggcata
ggcaaaggcgacacggcactggtgcaactgcccaatatcgccgaattctacatcgtgttc
ttcgcactcatgaaagcgggcatcgcgcccgtcaatgcgcttttcagccatcgcaagctg
gagcttggcgcctatgccagccagatcgaaccacggctgctgatcggctcacgccagcat
gaactcttcatggatgacgcctttgcccgcgaccttggcaaaaatctttccgcaccgctg
ctaacactttttgcaggcgaggccgaccatgcgtcgagcctcgaccactggatcgccacg
cctgcggacaaagccgttcctttctcgccaaccggcgctggcgaagtcgcctttttccag
ctttccggcggcagcaccggcacgccgaaactcatcccgcgcacgcataatgattatgat
tacagcgtgcgcgccagcgcggaaatctgcgcgctgacaccgcagacccgttttctctgc
gccctgcccaccgcgcataattatccaatgagttcgcccggcgcgctcggcgttttccat
gcgggcggctgtgtcgtcatggcccccaacccggaaccgctcaactgcttctccatcatc
gaacgtcatggcgtaaacatggtggcactggtgcctccggcagtggcgctctggctacag
gcagcccccgatcatctggcagcactcagctcgctgaaactcgtgcaggtgggtggcgca
agctttgcggaggcgcttgcccggcaggtgccacaggttctgggctgcaagctgcaacag
gtcttcggcatggccgaggggctggtcaactatacccgccttgacgacccggacgagatc
gtcttcaccacccagggccgtccgatcagcccggacgatgaaatcaggatcgtcgatgag
gatggcgaacccgtggccgaaggccagccaggaatgctggccacgcgcgggccttacacg
ttctgcggctattatcgcagccccgaacataatgcgcaggtcttcgacagtgaaggcttt
tattattcgggcgacgtggtccagcgcacgccggaaggctatctgcgcgtcgtgggccgc
gtgaaggaccagattaatcgcggcggcgagaaagttgccgccgaggagattgaaaacctg
atcctcctccatcccgatgtgacgcacgccgcacttgtcgccatgcaggatgaattgctg
ggcgagaaaagctgcgctttcatcgtctcgcgcaatcccgatctcaagccgcctgttctg
cggcgtcacctgctggcgctgggcgttgccgaatacaagcttccagaccgcatcaggctc
attgaaaccatgccgctcaccgcagttggcaagatcgacaaaaagcatctgcgcaagctt
tcaagcccatcctcccccggttag

DBGET integrated database retrieval system