KEGG   Brucella melitensis bv. 1 16M: BMEII0313Help
Entry
BMEII0313         CDS       T00072                                 

Definition
(GenBank) gluconate 2-dehydrogenase
Organism
bme  Brucella melitensis bv. 1 16M
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 CoA_binding_2 Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AAL53555
UniProt: Q8YD64
Position
II:328057..329031
Genome map
AA seq 324 aa AA seqDB search
MTKRDTTILVLGNFDDYAVQRLSDEFNVQRMARGDTALLGSDWVKDVKGIASMSKVSADL
IDALPNLEIIGNFGVGYDAVDARHAGANNVMVTNTPDVLTEEVADTTIGLLIDTVRELSK
AQEFLRRGEWGKQVRYPLSKLSLRGRKVGIFGLGRIGKAVARRIEAFGLPIAYHNRRKAA
DVAYDYYPSLKELAGAVDTLILVAPGGAETTRAVNMEVLQALGPEGVLINIGRGSVVDEE
ALAQALKDGTIAAAGLDVFANEPHVPQALLDAPNTVLLPHIGSASVKTRRAMADLVVDNL
IAWFDSGTAITPVPETVGVKAVRQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacgtgatacgactatactagtgcttggcaattttgatgattatgccgtgcag
cggctttcggacgagttcaatgttcagcgcatggcgcgtggcgacaccgcgcttctgggg
agcgactgggtaaaggacgtgaaaggcattgccagcatgtccaaggtcagcgccgacttg
atcgatgccttgcccaatctcgaaatcatcgggaatttcggcgtcggctatgatgcggtc
gacgccagacatgcgggcgcaaacaatgtcatggttacgaatacgccggatgtgctgacc
gaggaagtggccgatacgaccattggtctcctgatcgataccgtgcgcgaattgtcaaag
gcgcaggaatttctgcgtcgcggcgagtggggaaaacaggtgcgctatccgctgtcgaag
ctgtcgctgcgcgggcgcaaggtcggtattttcgggcttggccgcatcggcaaggctgtc
gcccgccgtatcgaagccttcggcctgccgatcgcctatcacaatcgccgcaaggccgcc
gatgtggcttatgattattatccgagcctcaaggaacttgccggagcggtggatacgctc
attctcgttgcccccggcggggcggaaaccaccagggcggtcaatatggaagtgttgcag
gcacttgggccggaaggcgtgctcatcaatatcgggcgaggctcggtcgtggatgaggag
gcgcttgcgcaagccctgaaggacggtacgattgctgctgcgggcctcgatgttttcgcc
aacgaaccgcatgtgccacaggcgcttctcgatgcgccgaacacggtgttgctgccgcat
atcggctcggcctcggtcaagacacgccgcgccatggccgatctcgtggtcgataatctc
attgcatggttcgacagcggtacggcgattacgcccgtgccggagacggtgggggttaaa
gcggtaaggcagtaa

DBGET integrated database retrieval system