KEGG   Brucella melitensis bv. 1 16M: BMEII0510Help
Entry
BMEII0510         CDS       T00072                                 

Definition
(GenBank) methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00670  One carbon pool by folate
bme01100  Metabolic pathways
bme01120  Microbial metabolism in diverse environments
bme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BMEII0510
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     BMEII0510
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     BMEII0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: AAL53752
UniProt: Q8YCL8
Position
II:535493..536452
Genome map
AA seq 319 aa AA seqDB search
MCANDVMQDAASSAENGAITMAQLIDGKKLAEDVVSTVKTETEKLVAATGVVPGIAVVIV
GEDPASQVYVASKSRKAKECGFHSVQHDLPETASEQELLNLIEGLNNDPAIHGILVQLPL
PGHIDSGRVIQTIAPEKDVDGFHFINVGKLGTGEVETAFVPCTPAGAMIMIERVHGRDLS
GLNAVVIGRSNIVGKPMFNLLLAANATVTVAHSRTKDLPAIARNADILVAAVGRPQMVKG
DWVKPGATVIDVGINRIPAPERGEGKTRLVGDVDFAEAEKVAGAITPVPGGVGPMTIAML
MANTLTAACRSAGMKKPVF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcaaacgacgtgatgcaggatgctgcatcatctgctgaaaacggagcgatcacg
atggcccaattgatcgatggcaagaagctcgccgaggatgtggtttccacggtgaaaacc
gaaaccgaaaaacttgtggcagcgaccggcgtcgttcccggtattgccgtggtgattgtc
ggtgaagacccggcaagtcaggtctatgttgcctcgaaaagccgcaaggccaaggaatgc
ggctttcattccgttcagcacgacttgccggaaacggcttccgaacaagagcttctcaac
ctgatcgaaggcctcaataacgaccccgccattcatggcattctggttcagttgcctttg
ccggggcacattgattcaggccgcgtgatccagaccatcgctcctgaaaaggacgtggac
ggcttccacttcatcaatgtgggcaagcttggcaccggcgaggtggaaacggctttcgtt
ccctgcacgccagccggcgcgatgattatgatcgagcgtgtgcatggccgcgacctttcc
ggcctcaatgccgtggtgatcgggcgttccaatattgtcggcaagccgatgttcaacctc
cttctggcggcaaatgcgacggtgacggttgcgcatagccgcaccaaggacctgcccgcg
attgcgcgcaatgccgatattctggtggcggcggtggggcgtccgcaaatggtcaaggga
gattgggtcaagccgggcgcgacggtgatcgatgtgggtatcaaccgcatcccggcaccg
gagcgcggcgagggcaagacaaggctcgtcggtgatgtcgattttgccgaggctgaaaag
gttgcaggcgcgatcacgccggttccgggcggggttggcccaatgaccatcgccatgctg
atggccaatacgctcaccgctgcctgccgcagtgcaggcatgaaaaaacccgttttctga

DBGET integrated database retrieval system