KEGG   Brucella melitensis bv. 1 16M: BMEII0724Help
Entry
BMEII0724         CDS       T00072                                 

Definition
(GenBank) endoglucanase h
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
bme00500  Starch and sucrose metabolism
bme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMEII0724
Enzymes [BR:bme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BMEII0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_26
Motif
Other DBs
NCBI-ProteinID: AAL53966
UniProt: Q8YC11
Position
II:complement(760811..761542)
Genome map
AA seq 243 aa AA seqDB search
MFLPWEDVDLTSLHAADAYARERGRSLLITIEPWSWARDWRVGPEDLLSGILNGRYDSNM
AAVCSEAAKLKSPVTIRWAQEMEDDAGQFTWAFWKPEGYVKAYRHVIDVCRKSLPSARYM
WSPKGEEGLEAYYPGDNYVDIIGLSVFGYQPFDQLEVGRDTTFVERTKPGYDRVARFNKP
IAIAELGYEGDDDYVRAWAAEANKPHAEFPAMTAVVYFNDREVYPWPRDVGRPDWRVANH
PLD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctgccatgggaggatgtcgatttaaccagtctccatgccgctgacgcctatgca
cgtgagcgcggccgttcgctgctgatcaccatagagccgtggtcatgggcgcgcgactgg
cgcgttgggccggaagatcttctgagcggaattttgaatggccgctacgattcaaatatg
gcggcggtttgttctgaggccgcaaaattgaaaagtcccgtcaccatccgctgggcgcag
gaaatggaagatgatgctggccagtttacctgggctttctggaaaccggaaggttacgta
aaggcctaccggcatgtaatcgacgtttgccgcaaatcgctgccgtcagcccggtatatg
tggtcgccgaagggcgaggaggggttggaagcctattatccaggcgacaactatgtcgat
atcatcggtttgtcggtcttcggataccagcccttcgatcaactggaggtgggccgcgac
accactttcgtggagcgtacaaagcccggttatgaccgtgtggcgcgcttcaacaagccg
attgccatcgctgagcttggctatgaaggcgacgacgattacgtgcgcgcctgggcggcg
gaggccaataagccccatgccgaattcccggccatgaccgccgtcgtctacttcaacgac
cgcgaagtctatccatggccacgcgacgtcgggcggcccgactggcgggtcgccaatcac
ccgctggattga

DBGET integrated database retrieval system