KEGG   Burkholderia metallica: WJ16_12400Help
Entry
WJ16_12400        CDS       T04871                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bmec  Burkholderia metallica
Pathway
bmec02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WJ16_12400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bmec02000]
    WJ16_12400
Enzymes [BR:bmec01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     WJ16_12400
Transporters [BR:bmec02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    WJ16_12400
   Histidine transporter
    WJ16_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_16 AAA_33 ATPase_2 G-alpha Zeta_toxin RYDR_ITPR PRK RsgA_GTPase AAA_22 APS_kinase AAA_23 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AOJ32255
UniProt: A0A1B4HVN3
Position
1:2751410..2752189
Genome map
AA seq 259 aa AA seqDB search
MNSQTQKLFVDDLHKRYGDNEVLKGVSLKANSGDVISVIGSSGSGKSTMLRCINFLEQPN
AGRIFVDREEVRTALDKTGALRAADTKQLQRVRTKLSMVFQHFNLWSHMNVIENVMEAPV
NVLGIPKKEAEERARQYLEKVGLAPRVEKQYPSHLSGGQQQRVAIARALAMHPDVMLFDE
PTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRVEEEGVPSE
VFAHPKSERLRGFLSGSLK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaattcccagactcagaagcttttcgtcgacgatctgcacaagcggtacggcgacaac
gaggtgctcaagggcgtatcgctgaaggcgaactcgggcgacgtgatcagcgtgatcggc
tcgtccggctccggcaagagcacgatgctccgctgcatcaacttcctcgagcagccgaat
gcgggccgcatcttcgtcgaccgcgaggaagtgcgcaccgcgctcgacaagaccggcgcg
ctgcgcgcggccgatacgaagcagctgcagcgcgtacgcaccaagctgtcgatggtgttc
cagcacttcaatctctggtcgcacatgaacgtgatcgagaacgtgatggaagcgcccgtg
aacgtgctcggcattccgaagaaggaggccgaggagcgcgcgcgccaatacctggagaaa
gtcggcctcgcgccgcgcgtcgagaagcagtatccgtcgcacctgtcgggcggccagcag
cagcgcgtggcgattgcgcgcgcgctggcgatgcacccggacgtgatgctgttcgacgag
ccgacgtcggcgctcgacccggagctggtgggcgaagtgctgaaggtgatgcagaagctg
gccgaggaaggccgcacgatgatcgtcgtcacgcacgagatgggtttcgcgcgcaacgtg
tcgaaccacgtgatgttcctgcaccagggccgcgtcgaggaagaaggcgtgccgtccgag
gtgttcgctcatccgaagagcgaacgcctgcgcgggttcctgtcgggcagcctcaagtaa

DBGET integrated database retrieval system