KEGG   Burkholderia metallica: WJ16_16600Help
Entry
WJ16_16600        CDS       T04871                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmec  Burkholderia metallica
Pathway
bmec00071  Fatty acid degradation
bmec00072  Synthesis and degradation of ketone bodies
bmec00280  Valine, leucine and isoleucine degradation
bmec00310  Lysine degradation
bmec00362  Benzoate degradation
bmec00380  Tryptophan metabolism
bmec00620  Pyruvate metabolism
bmec00630  Glyoxylate and dicarboxylate metabolism
bmec00640  Propanoate metabolism
bmec00650  Butanoate metabolism
bmec00900  Terpenoid backbone biosynthesis
bmec01100  Metabolic pathways
bmec01110  Biosynthesis of secondary metabolites
bmec01120  Microbial metabolism in diverse environments
bmec01130  Biosynthesis of antibiotics
bmec01200  Carbon metabolism
bmec01212  Fatty acid metabolism
bmec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WJ16_16600
   00630 Glyoxylate and dicarboxylate metabolism
    WJ16_16600
   00640 Propanoate metabolism
    WJ16_16600
   00650 Butanoate metabolism
    WJ16_16600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WJ16_16600
   00072 Synthesis and degradation of ketone bodies
    WJ16_16600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WJ16_16600
   00310 Lysine degradation
    WJ16_16600
   00380 Tryptophan metabolism
    WJ16_16600
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WJ16_16600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WJ16_16600
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WJ16_16600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmec04147]
    WJ16_16600
Enzymes [BR:bmec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WJ16_16600
Exosome [BR:bmec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WJ16_16600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOJ33237
UniProt: A0A1B4HYL0
Position
3:142601..143791
Genome map
AA seq 396 aa AA seqDB search
MTTQDPIVIVGMARTPMGGFQGDLAAASASDLGAVAIRAALERANVPAERIDEIVFGCVL
PAGQGQAPARQAALKAGLPLAAGATTVNKMCGSGMKAAMFAHDLLLAGSAGVAVAGGMES
MTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYEKGRLMGTFAEDCAQAYQFTREAQD
AFAIASLTRAQRAIAEGHFVSEIAPVTVKAGKTETVVSIDEQPGKAKLDKIPTLKPAFRD
GGTVTAANASSISDGAAALVMMRRSEAERLGLTPKAVIVGHSTYADKPGLFATAPIGALR
KLSEKTGWNLRDVDLFEINEAFAVVPMAAMRDLDLPHEKVNVHGGACALGHPIGASGARV
MVTLLAALETYGMKRGIASLCIGGGEATAIAIERIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaggatccgatcgtaatcgttggtatggcgcgtacgccgatgggcggtttt
cagggcgacctggcggcagccagcgcgagcgacctcggcgcggtggcgattcgcgcggcg
ctcgagcgcgcgaacgtgccggccgagcgcatcgacgaaatcgtgttcggctgcgtgctg
ccggcgggccagggccaggcgccggcgcggcaggccgcgctgaaggccgggctgccgctc
gcggcgggcgcgaccacggtcaacaagatgtgcggctcggggatgaaggccgcgatgttc
gcgcacgacctgttgctggccggttcggcgggcgtggcggtcgcgggcgggatggagagc
atgacgaatgcgccgtacctgctgccgaaggcgcgtgcgggaatgcggatgggccacggg
caggtgctcgaccacatgttcctcgacgggctcgaggacgcgtacgagaagggccgcctg
atgggcacgttcgcggaggattgcgcgcaggcgtaccagttcacgcgcgaggctcaggat
gcgttcgcgatcgcgtcgctgacgcgcgcgcaacgcgcgatcgccgaagggcatttcgtg
tcggagatcgcgccggtgaccgtgaaggccggcaagaccgaaacggtcgtgtcgatcgac
gaacagccgggcaaggcgaagctcgacaagatcccgacgctgaagccggcgttccgcgac
ggcggcacggtgacggccgcgaatgcgtcgtcgatctcggacggtgcggccgcgctcgtg
atgatgcgccgctcggaagccgagcgcctgggtctcacgccgaaggcggtgatcgtcggg
cattcgacctacgcggacaagccgggcctgttcgcgaccgcgccgatcggcgcgctgcgc
aagctgtcggagaaaaccggctggaacctgcgcgacgtcgacctgttcgagatcaacgaa
gcgttcgcggtggtgccgatggccgcgatgcgcgatctcgacctaccgcacgagaaggtc
aacgtgcacggcggcgcatgtgcgctcggccatccgatcggcgcgtcgggcgcacgcgtg
atggtgacgctgctggccgcgctcgaaacgtacggcatgaagcgcggcatcgcatcgctg
tgcatcggcggcggcgaagcgacggcgatcgcgatcgagcgcatcgcgtaa

DBGET integrated database retrieval system