KEGG   Burkholderia metallica: WJ16_29030Help
Entry
WJ16_29030        CDS       T04871                                 

Definition
(GenBank) ADP-ribose pyrophosphatase
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
bmec  Burkholderia metallica
Pathway
bmec00760  Nicotinate and nicotinamide metabolism
bmec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    WJ16_29030
Enzymes [BR:bmec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     WJ16_29030
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     WJ16_29030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like NUDIX_4 FAD_syn ATP-sulfurylase
Motif
Other DBs
NCBI-ProteinID: AOJ35547
UniProt: A0A1B4I583
Position
2:complement(2143524..2144564)
Genome map
AA seq 346 aa AA seqDB search
MSTQQNRRFDALVFIGRFQPPHRGHLNVLKSALSRAARVCVLIGSTDKPRTIKDPFSFDE
RRQMLASLLDASERDRVTIAPLQDSTYNDGDWVRWVQDAVASALGDVAQRKVGLIGHEKD
ATSYYLRMFPQWELVDVDATEDISATEIRDQYFAERPNSFVQWAVPEPVFGWLERFRTQP
EFAQLKSEAEFIAGYRKAWAAAPYPVTFVTVDAVVVHSGHILLVRRRSEPGRGLWALPGG
FVNQDERLDAACIRELREETGLKLPEPVLRGSIKDRQVFDHPTRSLRGRTITHACLFNFP
TGELPRVKGSDDADKARWVPLNEFAQMRGVMFEDHFDIAYHFLGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaacagaaccggcgcttcgacgcgctcgttttcattggtcgtttccagcct
ccgcatcgtggtcacctgaacgtgctgaagtcggcactgagccgggccgcgcgcgtgtgc
gtgctgatcggatcgaccgacaagccccgcaccatcaaggatccgttttcgttcgacgag
cgccgccagatgctggcttcgctgctcgacgcgtccgagcgcgaccgcgtcacgatcgca
ccgttgcaggattcgacctacaacgacggcgactgggtgcgctgggtgcaggacgccgtc
gcgtccgcgctcggcgacgtcgcgcagcgcaaggtcgggctgatcggccacgagaaggac
gccacgtcgtattacctgcggatgttcccgcaatgggagctcgtcgacgtcgacgcgacg
gaagacatttccgccaccgaaatccgcgaccagtatttcgccgaacgccccaacagcttc
gtgcaatgggccgtgccggaaccggtgttcggctggctcgagcgtttccgcacgcagccg
gaattcgcgcaactgaagtcggaagccgaattcatcgccggctatcgcaaggcgtgggcg
gccgcgccgtatcccgtcacgttcgtgacggtcgacgcggtggttgtgcactcgggccat
atcctgctcgtgcgccgccgcagcgagccgggccgcggcctgtgggcgctgccgggcggg
ttcgtgaaccaggacgagcggctcgacgcggcctgtatccgcgagctgcgcgaagaaacc
ggcctgaagctgccggagcccgtgctgcgcggctcgatcaaggatcgccaggtgttcgac
caccccacgcgttcgctgcgcgggcgcacgatcacgcacgcgtgcctgttcaacttcccg
accggcgaattgccgcgcgtgaagggcagcgacgacgccgacaaggcgcgctgggtgccg
ctgaacgaattcgcgcagatgcgcggcgtgatgttcgaggatcacttcgacatcgcgtat
cacttcttggggaagctgtga

DBGET integrated database retrieval system