KEGG   Burkholderia metallica: WJ16_31710Help
Entry
WJ16_31710        CDS       T04871                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bmec  Burkholderia metallica
Pathway
bmec00260  Glycine, serine and threonine metabolism
bmec01100  Metabolic pathways
bmec01110  Biosynthesis of secondary metabolites
bmec01120  Microbial metabolism in diverse environments
bmec01130  Biosynthesis of antibiotics
bmec01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WJ16_31710
Enzymes [BR:bmec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     WJ16_31710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AOJ36025
UniProt: A0A1B4I6H1
Position
2:complement(2757410..2758423)
Genome map
AA seq 337 aa AA seqDB search
MIDLRSDTVTRPSQAMLAAMTAAEVGDDVWGDDPTVLRLQAVMAERAGKEAGLFFPSGTQ
SNLSALMAHCERGDEYIVGQLAHTYKYEGGGAAVLGSIQPQPIENAPDGTLPIAKIAAAI
KPIDNHFARTRLLALENTIGGQVLPESYVQEATAFARSRGLSLHLDGARVCNAAVASGRS
IAELCAPFDTVSICFSKGLGAPVGSVLVGSHALIERAQRWRKVLGGAMRQSGILAAACLY
ALDHNVERLADDHANAAHLAEGLARIDAVKVLSHATNMVFAQFPEADCAPLEAWLKARGI
LTQMLYASRFVTHCDVSRADIDTFIDAVRAYFAQRRA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtgacacgtccgagccaggcaatgctggccgcgatg
actgccgccgaagtcggcgacgacgtatggggtgacgacccgaccgtgctgcgcctgcag
gcggtgatggccgagcgggccggcaaggaagcgggcctgttcttcccgagcggcacgcag
agtaacctctccgcactgatggcccattgcgaacgcggcgacgagtacatcgtcggccag
ctcgcgcacacctacaagtacgaaggcggcggcgcggccgtgctgggcagcatccagccg
cagccgatcgaaaatgcaccggacggcacgctgccgatcgcgaagatcgccgcggcgatc
aagccgatcgacaatcactttgcgcgtacgcgcctgctcgcgctcgaaaacacgatcggc
ggccaggttctgccggaaagctacgtccaggaagccaccgcgttcgcgcgcagccgcggt
ttgtcgctgcatctcgacggcgcgcgcgtgtgcaacgcggccgtcgcgtcgggccgttcg
atcgccgagctgtgcgcgccgttcgacaccgtatcgatctgcttctcgaaagggcttggc
gcgccggtcggctcggtgctggtcggcagccatgcgctgatcgagcgcgcgcagcgctgg
cgcaaggtgctcggcggcgcgatgcggcagtcgggcattctcgccgccgcgtgcctgtat
gcgctcgaccacaacgtcgagcggctcgccgacgatcacgcgaatgccgcgcatctcgcc
gaaggtctcgcgcgcatcgacgcggtgaaggtgctgtcgcatgcgacgaacatggtgttc
gcgcaattccccgaagccgattgcgcgccgctcgaggcgtggctcaaggcgcgcggaatc
ctcacgcagatgctgtacgcatcgcgtttcgtcacgcactgcgacgtatcgcgcgcggac
atcgacacctttatcgacgcggtccgcgcgtatttcgcgcagcgccgcgcgtaa

DBGET integrated database retrieval system