KEGG   Brucella melitensis bv. 3 Ether: DK62_2144Help
Entry
DK62_2144         CDS       T03393                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00030  Pentose phosphate pathway
bmee00480  Glutathione metabolism
bmee01100  Metabolic pathways
bmee01110  Biosynthesis of secondary metabolites
bmee01120  Microbial metabolism in diverse environments
bmee01130  Biosynthesis of antibiotics
bmee01200  Carbon metabolism
Module
bmee_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bmee_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DK62_2144 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DK62_2144 (gnd)
Enzymes [BR:bmee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     DK62_2144 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     DK62_2144 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N ApbA
Motif
Other DBs
NCBI-ProteinID: AIJ86611
Position
2:complement(47822..49210)
Genome map
AA seq 462 aa AA seqDB search
MVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFEELAANIR
KPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPNDPTFVGM
GVSGGAEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAGHFVKTIH
NGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVLKSTDPET
GKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREEAAKAYKS
GARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTARIWRAGC
IIRSQLLDDIAQAFEGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLPLPALGSAL
SYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPWG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtcggccttggcgtcatgggctccaacctggcgctgaacatagccgagaagggctac
accgtggccgtctatgaccgtgatgagcctgtgctgaaagctttcatcgaaaaggctggc
cggctgcgcgacaagatcattccctgcccgacctttgaggaactggccgcgaatatccgc
aagccccgtccgatcatctttctcatcaaggccggtgcgccagtcgataccgagaccacc
cgcctcaaggcattccttgagaagggcgatatcatgatcgatgcaggcaattccgattat
cgcgatacggtgcgccgcctgaaggctcttggccccaatgatccgacctttgtcggcatg
ggcgtttcgggtggggcggaaggcgcgcgccatggtccgtcgatgatggtcggcggcacg
gagcaggcctatgagcgcatcgcgccgatcctgcttgctgtcgccgccaaatatcagggc
gagccctgctgtgcgctggtcggcccggatggcgcgggtcatttcgtcaaaaccatccat
aacggtattgaatatgccgatatgcagatgatcgccgaaatttacggcattctgcgcgat
ggccttggcctttcagctccggccatcggcgatgtgttcgagaagtggaacgaaggtccg
ctcaattcctatctgattgaaatcaccgccaaggttctcaagtccaccgacccggaaacc
ggcaaggcgatggtcgatatgatccttgatgaagccggccagaagggtacaggccgctgg
gctgccattgaggcgcagatactgggcgttccggccacgggcatcgaagccgcggttgcc
gcccgttcgctgtcctccatgaagggcgagcgggaagaggccgccaaggcgtataaatcc
ggtgcacgcacacttgatattgccaaccagacccgcttcctttccgatctggaacagggc
ttgctggcgggcaagatcgccgcttatgcgcaaggctttgcagtgatggaagccgcctca
agggagcatggctggaacattccgcttgccaccacggcgcgcatctggcgcgcgggctgc
atcatccgctcgcagcttctggatgatattgcgcaggcttttgaaggcaatgaaagccgc
aacctgctcatggccccggccttcgtgccgcgcatggaaacatctgtgaaaagccttcgc
cagattgtcgcgcaggccgcccttgccagcctgccgctgcccgcgctcggctctgcgctc
agctatttcgacagctatacgcaggcgcttggtacggccaatctcattcagggccagcgc
gatttcttcggctcgcacggcttcaaacgcattgacaaggagggggatttccacggcccc
tggggctga

DBGET integrated database retrieval system