KEGG   Brucella melitensis bv. 3 Ether: DK62_2232Help
Entry
DK62_2232         CDS       T03393                                 

Definition
(GenBank) (2,3-dihydroxybenzoyl)adenylate synthase
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee01053  Biosynthesis of siderophore group nonribosomal peptides
bmee01110  Biosynthesis of secondary metabolites
bmee01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    DK62_2232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bmee01008]
    DK62_2232
Enzymes [BR:bmee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     DK62_2232
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     DK62_2232
Polyketide biosynthesis proteins [BR:bmee01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    DK62_2232
   Bacillibactin synthetase
    DK62_2232
  Nonlinear NRPS
   Vibriobactin synthetase
    DK62_2232
   Myxochelin synthetase
    DK62_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C GH3
Motif
Other DBs
NCBI-ProteinID: AIJ86637
Position
2:143833..145452
Genome map
AA seq 539 aa AA seqDB search
MTIEFTHWPPARERLYREKGYWIDKPLTRALEEQAAMRPDAPAILCGERRFTYAELDRLS
SNLASRLAAAGIGKGDTALVQLPNIAEFYIVFFALMKAGIAPVNALFSHRKLELGAYASQ
IEPRLLIGSRQHELFMDDAFARDLGKNLSAPLLTLFAGEADPASSLDHWIATPADKAVPF
SPTGAGEVAFFQLSGGSTGTPKLIPRTHNDYDYSVRASAEICALTPQTRFLCALPTAHNY
PMSSPGALGVFHAGGCVVMAPNPEPLNCFSIIERHGVNMVALVPPAVALWLQAAPDHLAA
LSSLKLVQVGGASFAEALARQVPQVLGCKLQQVFGMAEGLVNYTRLDDPDEIVFTTQGRP
ISPDDEIRIVDEDGEPVAEGQPGMLATRGPYTFCGYYRSPEHNAQVFDSEGFYYSGDVVQ
RTPEGYLRVVGRVKDQINRGGEKVAAEEIENLILLHPDVTHAALVAMQDELLGEKSCAFI
VSRNPDLEPPVLRRHLLALGVAEYKLPDRIRLIETMPLTAVGKIDKKHLRKLSSPSSPG
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaatttacccattggccaccggcacgcgaacgcctctatcgcgaaaagggc
tactggatcgacaaacccctcacccgcgcactggaagaacaggccgccatgcggcccgat
gcgcccgctatcctctgcggcgagcggcgtttcacctatgccgaactcgaccgtctgtct
tccaacctggcctcccggcttgcggcagccggcataggcaaaggcgacacggcactggtg
caactgcccaatatcgccgaattctacatcgtgttcttcgcactcatgaaagcgggcatc
gcgcccgtcaatgcgcttttcagccatcgcaagctggagcttggcgcctatgccagccag
atcgaaccacggctgctgatcggctcacgccagcatgaactcttcatggatgacgccttt
gcccgcgaccttggcaaaaatctttccgcaccgctgctaacactttttgcaggcgaggcc
gaccctgcgtcgagcctcgaccactggatcgccacgcctgcggacaaagccgttcccttc
tcgccaaccggcgctggcgaagtcgcctttttccagctttccggcggcagcaccggcacg
ccgaaactcatcccgcgcacgcataatgattatgattacagcgtgcgcgccagcgcggaa
atctgcgcgctgacaccgcagacccgttttctctgcgccctgcccaccgcgcataattat
ccaatgagttcgcccggcgcgctcggcgttttccatgcgggcggctgtgtcgtcatggcc
cccaacccggaaccgctcaactgcttctccatcatcgaacgtcatggcgtaaacatggtg
gcactggtgcctccggcagtggcgctctggctacaggcagcccccgatcatctggcagca
ctcagctcgctgaaactcgtgcaggtgggtggcgcaagctttgcggaggcgcttgcccgg
caggtgccacaggttctgggctgcaagctgcaacaggtcttcggcatggccgaggggctg
gtcaactatacccgccttgacgacccggacgagatcgtcttcaccacccagggccgtccg
atcagcccggacgatgaaatcaggatcgtcgatgaggatggcgaacccgtggccgaaggc
cagccaggaatgctggccacgcgcgggccttacacgttctgcggctattatcgcagcccc
gaacataatgcgcaggtcttcgacagtgaaggcttttattattcgggcgacgtggtccag
cgcacgccggaaggctatctgcgcgtcgtgggccgcgtgaaggaccagattaatcgcggc
ggcgagaaagttgccgccgaggagattgaaaacctgatcctcctccatcccgatgtgacg
cacgccgcacttgtcgccatgcaggatgaattgctgggcgagaaaagctgcgctttcatc
gtctcgcgcaatcccgatctcgagccgcctgttctgcggcgtcacctgctggcgctgggc
gttgccgaatacaagcttccagaccgcatcaggctcattgaaaccatgccgctcaccgca
gttggcaagatcgacaaaaagcatctgcgcaagctttcaagcccatcctcccccggttag

DBGET integrated database retrieval system