KEGG   Brucella melitensis bv. 3 Ether: DK62_2250Help
Entry
DK62_2250         CDS       T03393                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00860  Porphyrin and chlorophyll metabolism
bmee01100  Metabolic pathways
bmee01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DK62_2250 (hemN)
Enzymes [BR:bmee01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     DK62_2250 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C CbiC
Motif
Other DBs
NCBI-ProteinID: AIJ86685
Position
2:160844..162196
Genome map
AA seq 450 aa AA seqDB search
MSQTIVEKYGEARLPRYTSYPTAPNFKAEIVPGAYGRWLNSIPDDQDTSLYLHIPFCRSM
CWYCGCHTTITEKDQPILDYLDVLHKEIEMIARQRGRSFNLGEIHFGGGTPTIIQPDELV
ALMAALRDRLGFAGELNAAVEIDPRRMTPEMAAALAYSGITRASLGVQSFDPKVQKAINR
IQTAKTTLETVSSLRKNNIQAINFDLIYGLPHQTVASCIETVDIAVEMRPNRFAVFGYAH
VPGFKKHQRLIDEKALPDVQARHAQAAAIAERLVEAGYEQIGLDHFALPDDDLSIAQREG
RLHRNFQGYTTDACKTLIGIGASAIGRFGNGYHQIIVPPGLYASCVASGELPTAKIYELT
AEDRVRADVIEQLMCNFSVNVAAVCAAHGFDPEVLMKQNDTLDELEKDGLVQREGFMVRV
DGRHRFIVRAVASAFDAYLASSKTNFSKTA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagacaatcgtggaaaaatatggcgaggcgcggctaccccggtatacgagctac
ccgacggctcccaatttcaaggccgagattgtgcccggtgcctatgggcgctggctgaat
tcgatcccggacgatcaggacacctcgctttatcttcatattccgttttgccggtctatg
tgctggtattgcgggtgccacaccacgattacggagaaagaccagccgatcctcgattat
ctcgatgttctgcacaaggaaatcgagatgatagccaggcaacgcggccgcagtttcaat
ctcggtgaaattcattttggcggcggaacgccgaccatcattcagcccgatgaattagtc
gcactcatggcggcccttcgagaccggctcggctttgccggggaattgaatgcagcggtg
gagatcgatccgcgccggatgacgcctgaaatggccgcagccctggcatattccggcata
acgcgggcaagtcttggtgtgcagagcttcgaccccaaggtgcaaaaggcaatcaaccgc
attcaaacggccaagaccacgcttgaaaccgtctcaagcctgcggaagaacaatattcag
gcgataaacttcgaccttatctatgggttgccacatcagacggtggcatcctgcatcgag
acagtcgatatagcggttgagatgcggccaaaccggtttgcggtatttggctatgcgcat
gtgccgggtttcaaaaagcaccagagactgatcgatgagaaggcgcttcccgatgtgcag
gcgcggcacgcccaggcagcggcaattgccgagcgtctggttgaggccggttacgaacag
atcggtctggatcatttcgcgctgccggatgatgatctctctatcgcccagcgcgagggg
cggctgcatcgcaatttccagggctataccaccgatgcctgcaagacgctgatcgggatc
ggcgcttctgcaattggcaggttcggcaatggctatcatcagattatcgttcctccgggg
ctttatgcgagctgtgttgcatcgggtgaactgcccaccgccaagatttatgaactgacg
gcggaggaccgggtgagggccgatgtgattgaacagctcatgtgcaatttctcggtcaat
gtagccgcagtctgcgctgcacacggcttcgacccggaagtgctgatgaagcaaaacgac
acgctggatgaactggagaaagacggcctcgtgcagcgggaagggtttatggttcgcgtg
gatggcaggcatcgcttcatcgtgcgcgccgttgcatcggctttcgatgcctatctggcc
agctcgaaaacaaacttcagcaagactgcctga

DBGET integrated database retrieval system