KEGG   Brucella melitensis bv. 3 Ether: DK62_2543Help
Entry
DK62_2543         CDS       T03393                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00520  Amino sugar and nucleotide sugar metabolism
bmee01100  Metabolic pathways
bmee01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DK62_2543 (nagA)
Enzymes [BR:bmee01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     DK62_2543 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AIJ86556
Position
2:469274..470437
Genome map
AA seq 387 aa AA seqDB search
MKKSAIAGARIFDGERFHDQSALVFSDGQIEAIVPEASLAEGHEIERLKGGVLAPGFIDA
QVNGGGGRMLNDEPTPETMFVIAGGHRKYGTTSLLPTLITDTMPVRDRAIEAAIEAVKAD
RGVAGLHLEGPHLAPARKGAHLAELMRPVNDADIALYIHTARQIGTLLVTLAAEQVTPEQ
VRRLSDGGVIVSIGHSDTTAEEAFRRFDAGARSVTHLYNAMSQIGHRAPGLAGAALDHPD
IWCGIVADGHHVDPMALRLALRAKRGDAHLFLVTDAMALVGSDAESFEINGRSVRRVPGG
ICSKLVLPDGTIAGSDLDMASAVRFAVAELELTLAEALRMASLYPARYLRLNDRGRFRPG
MRMDAVHLDDGLFAKSTWLSGEKQIAG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatcagcaattgcaggcgcgcgcatcttcgacggtgagcgctttcatgaccag
agcgcgctggtattcagcgatggccagatcgaggccatcgtaccggaagcatcgcttgcc
gagggccacgaaatcgaaaggctgaagggcggcgttcttgcccccggtttcatcgatgcg
caggtgaatggcggcggcgggcgtatgctcaatgacgagccgacgcccgaaaccatgttc
gtgattgccggcgggcacaggaaatacggcacgaccagcctgttgccgacgctcatcacc
gatacgatgcccgtgcgtgaccgcgccattgaggcggcgattgaagcggtgaaggctgac
aggggggttgctggcctgcatctggaaggcccgcatctggcgccagcgcgcaaaggcgcg
catctggcggaactgatgcgcccggtcaatgatgccgatattgcgctctatatccataca
gccaggcagattggcaccttgctggtgacgctcgcggccgaacaggtgacgcctgaacag
gtgcgccgcttgagcgatggaggcgtgatcgtcagcattggccacagcgacacgaccgct
gaagaagccttccggcgcttcgatgccggtgcgcgcagcgtgacgcatctttataatgcc
atgagccagattggtcatcgcgcgccgggtcttgccggtgcggcgctcgatcatcccgat
atctggtgcggtatcgttgcggatgggcatcatgtcgatccgatggcgctgcggctggcg
ctgcgtgccaagcgcggcgatgcgcatctgttcctcgtgacggacgccatggcgcttgtc
ggatcggatgcggaaagcttcgagataaacgggcgcagcgttcgccgtgtgccgggcggc
atctgctccaagctggtcctgccggatggcaccattgccggttccgatctcgacatggct
tcggcggtgcggtttgccgtggcagaactggaactgacgcttgccgaggcgctgcgcatg
gcaagcctctatccggcgcgctatctgcgccttaatgatcgcggccggttccgtccggga
atgcgcatggatgccgtgcatctggatgacgggctgttcgccaaatccacatggctttcc
ggcgaaaagcagattgcaggctga

DBGET integrated database retrieval system