KEGG   Brucella melitensis bv. 3 Ether: DK62_2670Help
Entry
DK62_2670         CDS       T03393                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00030  Pentose phosphate pathway
bmee00480  Glutathione metabolism
bmee01100  Metabolic pathways
bmee01110  Biosynthesis of secondary metabolites
bmee01120  Microbial metabolism in diverse environments
bmee01130  Biosynthesis of antibiotics
bmee01200  Carbon metabolism
Module
bmee_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bmee_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bmee_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DK62_2670 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DK62_2670 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmee04147]
    DK62_2670 (zwf)
Enzymes [BR:bmee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     DK62_2670 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     DK62_2670 (zwf)
Exosome [BR:bmee04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DK62_2670 (zwf)
  Exosomal proteins of colorectal cancer cells
   DK62_2670 (zwf)
  Exosomal proteins of bladder cancer cells
   DK62_2670 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AIJ86624
Position
2:complement(605292..606767)
Genome map
AA seq 491 aa AA seqDB search
MTSQTIPVDPFDCIVFGGTGDLAERKLIPALYQRQRAGQLSDPTRIIGASRSQMTDDEYR
TFAGNAIKEHVKPEEVDQAEVEIFLKRLHYVAVDAKSDEGWDALKTLIGKKPEKIRAFYL
AVSPTLFGDIATRLKAHGLITRDTRIVVEKPIGRDLDSAKALNDTLGSVFREDQIFRIDH
YLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAEAVGLEGRAGYYDKAGALRDMVQ
NHILQLLCLVAMEPPSSIEADAVHDEKVKVLRSLQPISTHNVEELTVRGQYRAGASAGGP
VKGYLEDLESDTSNTETFVALKAEIANWRWAGVPFYLRTGKRLATRVSEIVITFKPIPHS
IFGESAGKVIANQLVIRLQPDEGVKQWLMIKDPGPGGMRLRHMPLDMSFAESFEDRNPDA
YERLIMDVVRGNQTLFMRRDEVEAAWRWIDPILQAWEFNSQPVQGYTAGTWGPSSSIALI
ERDGRTWHESL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtcagacaattccggtagatcccttcgactgcatcgtttttggtggcaccggc
gatcttgccgagcgcaagcttattccggcgctttatcagcgccagcgcgcaggccagctt
tccgaccccacacgcatcatcggcgcctcgcgcagccagatgaccgacgacgaatatcgc
accttcgccggcaatgcgatcaaggaacatgtgaaaccggaagaggtggatcaggccgaa
gttgaaatcttcctcaagcggctgcactatgtggcggtggacgccaagtccgacgagggc
tgggatgcgctgaagaccctgatcggcaagaagccggaaaagatccgagccttttatctg
gccgtcagcccgaccctgttcggcgatatcgccacgcggctcaaggcgcatggcctcatc
acgcgcgatacgcgcatcgtcgtggaaaagccgattggccgcgatctcgattccgccaag
gcgctcaacgacacgctgggcagtgtgttccgcgaagaccagattttccgcatagaccac
tatctcggcaaggaaacggtgcagaacctgatggcgctgcgctttgccaatgcgctctac
gagccgctgtggaactccgcccatatcgaccatgtgcagatcacggtggcggaagccgtg
ggccttgaaggccgcgcaggctattacgacaaggcgggcgcgctgcgcgacatggtgcag
aaccacattctccagcttctctgccttgttgccatggaaccgccatcctcgattgaggcc
gacgccgtacacgacgagaaggtaaaggttctgcgctccctgcagccgatctccacgcat
aatgtcgaggaactgacggtccgcggacaatatcgcgcgggcgcttccgcaggcgggccg
gtcaagggctatctggaagaccttgaaagcgacaccagcaatacggaaacattcgtggcg
ctgaaggcggaaatcgccaactggcgctgggcgggtgtgccgttctatctgcgcaccggc
aagcgccttgccacgcgtgtttcggaaatcgtcatcacgttcaagcccattccgcattcc
atctttggcgaaagcgcgggcaaggtgattgccaatcagcttgtcatccgcctgcaaccg
gacgaaggcgtgaagcaatggctgatgatcaaggatcccggtccgggtggaatgcgcctg
cgccacatgccgctcgacatgagctttgcggaatccttcgaggatcgcaacccggatgcc
tatgagcgcctcatcatggatgtggtgcgcggcaaccagaccctgttcatgcgccgcgac
gaagtggaagcggcctggcgctggatcgacccgatccttcaggcatgggagttcaacagc
cagcccgtgcagggctatacggctggcacatgggggccttcgtcctccatcgcgctcatt
gagcgcgatggccgcacctggcacgaaagcctctaa

DBGET integrated database retrieval system