KEGG   Brucella melitensis bv. 3 Ether: DK62_2976Help
Entry
DK62_2976         CDS       T03393                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00071  Fatty acid degradation
bmee00072  Synthesis and degradation of ketone bodies
bmee00280  Valine, leucine and isoleucine degradation
bmee00310  Lysine degradation
bmee00362  Benzoate degradation
bmee00380  Tryptophan metabolism
bmee00620  Pyruvate metabolism
bmee00630  Glyoxylate and dicarboxylate metabolism
bmee00640  Propanoate metabolism
bmee00650  Butanoate metabolism
bmee00900  Terpenoid backbone biosynthesis
bmee01100  Metabolic pathways
bmee01110  Biosynthesis of secondary metabolites
bmee01120  Microbial metabolism in diverse environments
bmee01130  Biosynthesis of antibiotics
bmee01200  Carbon metabolism
bmee01212  Fatty acid metabolism
bmee02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DK62_2976
   00630 Glyoxylate and dicarboxylate metabolism
    DK62_2976
   00640 Propanoate metabolism
    DK62_2976
   00650 Butanoate metabolism
    DK62_2976
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK62_2976
   00072 Synthesis and degradation of ketone bodies
    DK62_2976
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK62_2976
   00310 Lysine degradation
    DK62_2976
   00380 Tryptophan metabolism
    DK62_2976
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DK62_2976
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DK62_2976
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK62_2976
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmee04147]
    DK62_2976
Enzymes [BR:bmee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DK62_2976
Exosome [BR:bmee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DK62_2976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIJ87261
Position
2:926217..927407
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPRAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccaggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcgcgcggtcatcaccggc
catgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgtggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system