KEGG   Brucella melitensis bv. 3 Ether: DK62_3060Help
Entry
DK62_3060         CDS       T03393                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bmee  Brucella melitensis bv. 3 Ether
Pathway
bmee00051  Fructose and mannose metabolism
bmee00520  Amino sugar and nucleotide sugar metabolism
bmee01100  Metabolic pathways
bmee01110  Biosynthesis of secondary metabolites
bmee01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DK62_3060
   00520 Amino sugar and nucleotide sugar metabolism
    DK62_3060
Enzymes [BR:bmee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DK62_3060
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     DK62_3060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 DUF4398
Motif
Other DBs
NCBI-ProteinID: AIJ86797
Position
2:1016814..1018229
Genome map
AA seq 471 aa AA seqDB search
MSFIPVIISGGSGSRLWPLSRDAHPKPFIKLPDGETLIGKTYARASRLVNAEQILTVTNR
DFLFLTLDAYAAAGAAQMENTFLLEPLGRDTAPAVALAALHAAEAYGPDATLLVMPADHL
IEDEQAFAEAVAKARALAEAGRIVTFGIVPDRPETGFGYIEVQGTDVQRFVEKPDEATAQ
TYVESGRYFWNSGMFCFKALSMIDAMQRYAPQVLAGARAALAQARRGNNGETKTLEIARD
EFAATPAISIDYAVMEKADNMACVPVSCGWSDIGSWAAMADLVTPDENGNRLRGETVLED
TTNSFVLSETRLVSLVGVHDLLVVDTPDALLVAHRDKAQEVRSVFNKLRKQGHEAAKLHR
TAHRPWGTYTVLEEGDGFKIKRIEVKPGRRLSLQAHHHRSEHWIVVSGTAKVTNGDREIL
LTTNQSTYIPCGFRHRLENPGILPLVLIEVQSGEYLGEDDIVRYDDVYGRV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcataccggtaattatcagcgggggatcgggttcaaggctttggccgctttcg
cgggatgcacatccaaaaccctttatcaaactgccggatggcgaaacactcatcggcaag
acctatgcgcgcgcttcgcgccttgtaaacgccgaacagatccttacggttacgaaccgc
gattttcttttcctgacgctcgacgcttatgcggcggcaggtgccgcgcagatggaaaac
actttccttctggagccgcttggccgcgacaccgcgcccgcagtggcgcttgccgccctt
catgccgctgaagcctatgggccggatgccacgcttctggtcatgccggccgatcacctg
atcgaggatgaacaagccttcgcggaagcggttgcgaaagcgcgcgcgcttgccgaggca
gggcgcatcgtcaccttcggcattgtgccggatcggcccgagaccggcttcggctatatc
gaagtgcaaggtacggatgttcagcgatttgtcgaaaagccggatgaggccaccgcccag
acctatgtggaaagcggacgctatttctggaattccggcatgttctgcttcaaggcattg
agcatgatcgacgccatgcagcgttacgcaccgcaggtactggcaggcgctagggctgcc
ctcgcccaggcccggcgtggcaataacggcgagaccaaaacccttgaaatcgccagggac
gagtttgccgcaacgcctgccatttccatcgactacgcagtcatggaaaaggcggacaat
atggcctgcgtgcccgtttcctgcggctggtcggatatcggctcatgggcggcgatggcc
gatctcgtgacacccgatgaaaacggcaatcgcctgcgcggagaaactgttctggaagat
acgaccaacagtttcgtcctttctgaaacccgtctggtgagccttgtcggtgtgcatgat
cttctcgtggttgacacgccggacgcccttctcgtcgctcatcgcgacaaagcgcaggaa
gtacgcagcgttttcaacaaattgcgcaagcaaggtcatgaagctgcaaagctgcaccgc
acagcccatcgcccatggggcacctataccgtgctggaagagggcgacggcttcaagatc
aaacggatcgaggtaaagccagggcggcgcctcagccttcaggcccatcaccaccgctcc
gaacactggatcgtggtgtccggcacggcaaaggtgacgaatggcgaccgggaaatcctg
ctcaccaccaatcagtcaacctatattccctgcggtttccgccaccggttggaaaatccc
ggtattttgcccctcgtcctgatcgaggtgcagagcggcgaatatctcggtgaagacgac
atcgtgcgctatgacgatgtttacggacgcgtttga

DBGET integrated database retrieval system