KEGG   Brucella melitensis bv. 3 Ether: DK62_519Help
Entry
DK62_519          CDS       T03393                                 

Gene name
trmFO
Definition
(GenBank) m(5)U-54 methyltransferase
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
bmee  Brucella melitensis bv. 3 Ether
Brite
KEGG Orthology (KO) [BR:bmee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bmee03016]
    DK62_519 (trmFO)
   03036 Chromosome and associated proteins [BR:bmee03036]
    DK62_519 (trmFO)
Enzymes [BR:bmee01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     DK62_519 (trmFO)
Transfer RNA biogenesis [BR:bmee03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    DK62_519 (trmFO)
Chromosome and associated proteins [BR:bmee03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    DK62_519 (trmFO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA DAO NAD_binding_8 FAD_binding_2 Pyr_redox_2 FAD_oxidored AlaDh_PNT_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIJ84525
Position
1:529479..530879
Genome map
AA seq 466 aa AA seqDB search
MSNNTDLSPVHVIGGGLAGSEAAWQIAQAGVPVVLHEMRPVRGTDAHKTEQLAELVCSNS
FRSDDAETNAVGVLHAEMRLAGSLIMACADAHQVPAGGALAVDREGFSQAVTARLEAHPL
ITIEREEITGLPPTEWGTTIIATGPLTAPSLAEAIAAETDTDALAFFDAIAPIIHFDSIN
MDVCWFQSRYDKVGPGGTGKDYINCPMDKEQYEAFVAALIEGDKTDFKEWEGTPYFDGCL
PIEVMAERGPETLRHGPMKPMGLTNAHNPTVKPYAVVQLRQDNALGTLYNMVGFQTKLKY
GSQTGIFKMIPGLENAEFARLGGLHRNTYLNSPVLLDNVLRLKSRQTLRFAGQVTGCEGY
VESSAIGLLAGRFTAAEKLSQAAVPPPPTTAFGALLGHITGGHIVTDDEPGKRSFQPMNV
NFGLFPPVDVPKPEGKRLRGKEKTIAKKRALSARALADCRNWLSLY
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaataccgatctctcccccgttcacgtcattggcggcggccttgccggcagc
gaagccgcctggcagatcgcacaggccggcgtaccggtcgtgctgcacgaaatgcgcccg
gttcgcggcaccgatgcgcacaagaccgaacagcttgcagagctcgtctgttccaactcc
ttccgctccgacgacgcagaaaccaacgccgtcggtgttctccatgccgagatgcgcctt
gccggatcgctcatcatggcttgcgcggatgcccatcaggttcccgctggcggtgcgctg
gccgttgaccgtgaaggcttttcgcaggccgtaaccgccagactggaagcccatccgctc
atcaccatcgagcgcgaggagatcaccggcctgccgccgaccgaatggggaacgacgatc
atcgccaccggcccgctgaccgcaccgtcgctggccgaagccatcgccgctgaaaccgat
acggatgcgcttgcctttttcgatgcaattgcgcccatcattcatttcgattcaatcaat
atggatgtgtgctggttccagtcgcgctatgacaaggttggtcccggcggtactgggaaa
gattatatcaactgcccgatggacaaggagcagtacgaagccttcgtcgccgccctcatc
gaaggcgacaagacggacttcaaggaatgggaaggcacgccctatttcgatggttgcctg
ccgatcgaggtgatggctgagcgcggaccggaaacgctgcgtcacggcccgatgaaaccg
atgggccttaccaatgcgcataacccgactgtgaagccctatgcggtcgtgcagttgcga
caggacaatgcgcttggcacgctctacaacatggtgggtttccagacgaagctgaaatat
ggctcgcagacgggcatttttaaaatgatacccggcctggagaacgcggaatttgcacgc
cttggcggcctgcaccgcaacacctaccttaactctcccgtattgctcgacaatgttctg
cgtctcaaatcccgtcagacattgcgttttgcaggtcaggtaacgggttgtgagggctat
gtcgaatcgtcggccatcggcctgctggccggtcgctttacggctgcggaaaagcttagt
caggctgccgtgccgcccccgcccacgacggctttcggcgcgctgcttggccatattacc
ggtggccatatcgttaccgatgacgaacccggcaagcgttccttccagccgatgaacgtg
aatttcggcctgtttccgcccgttgacgtacccaaacccgaaggcaagcgcctgcgcggc
aaggaaaagaccattgccaaaaagcgcgcgctttccgcacgcgcccttgccgattgccga
aactggctcagcttgtactga

DBGET integrated database retrieval system