KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_181Help
Entry
BG04_181          CDS       T03825                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00030  Pentose phosphate pathway
bmeg00480  Glutathione metabolism
bmeg01100  Metabolic pathways
bmeg01110  Biosynthesis of secondary metabolites
bmeg01120  Microbial metabolism in diverse environments
bmeg01130  Biosynthesis of antibiotics
bmeg01200  Carbon metabolism
Module
bmeg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bmeg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BG04_181 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG04_181 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmeg04147]
    BG04_181 (zwf)
Enzymes [BR:bmeg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BG04_181 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BG04_181 (zwf)
Exosome [BR:bmeg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BG04_181 (zwf)
  Exosomal proteins of colorectal cancer cells
   BG04_181 (zwf)
  Exosomal proteins of bladder cancer cells
   BG04_181 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJI24394
UniProt: A0A0B6AX10
Position
complement(148433..149935)
Genome map
AA seq 500 aa AA seqDB search
MEAMTFVLFGSTGDLAKRKIYPALYNLFVDGKIPKSISVVGLGRREMSDADFQKKVEESI
HTFSRRVEKDSSLMQHFLSAFRYSQLDATNAEDYKSVLNLVEAREAELNIPSNRMFYLSV
APEFFGTIAEHIKDSGLGATKGWKRLIIEKPFGHDLQSARQLNENLSKAFKEEEIYRIDH
YLGKSMVQNLEALEFANPILQSLWNNEHIANIQITASETVGVEERASYYDHSGAIRDMVQ
NHMLQMLMMTAMHLPARISADDIRNEKINVLKALRPLVKEEMDLDVVRGQYEAGKINGAS
VPSYINEPGVSPSSQTDTFLAARLYIDNSLWKGVPFYIRTGKRMAEKVTRIVIEFKDSLK
ELYLDKGETTSPNLLIIEINPHENITLQLNSKNPFNHGHIEPVQINFSGQQEGAPEAYER
LIADACAGDSTFFAHWKEVELAWEWVQPLLEAFEENTVPLYKYAAGSYGPDASYALLEKD
GFKWWLDEETASQSREVQLV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatgacttttgttttattcggttcaacaggtgatttagcgaaacgcaaaatt
tatcctgcactctataatttatttgtagacgggaaaatccctaaatcaatttctgttgta
ggactaggcagaagggagatgtccgatgcagattttcagaaaaaagtagaagaatctatt
cacactttttcacgtcgcgtcgaaaaagattcatctcttatgcagcattttctgtcagct
tttcgctacagccaattggatgcaaccaatgctgaagactataaaagtgtgttaaatcta
gtagaagcacgagaagcagaattaaatattccaagcaaccgaatgttttatctctccgtt
gcaccagaatttttcggtacgattgccgagcatattaaagacagtggcttaggtgctaca
aaaggttggaaacggttaattattgaaaaaccatttggccatgatctacagtcagctcgt
caattaaacgaaaacttaagcaaagcgtttaaagaagaagagatttaccgcattgaccac
tatcttggcaagtcgatggtacaaaatttagaagcgctggaattcgctaatcctattctt
caatcattatggaataacgaacatattgcgaatatacaaattacagcaagtgaaacggtc
ggcgtagaggaaagagcaagctattatgaccattcaggagcgattcgagatatggttcaa
aatcatatgctgcaaatgctgatgatgacggctatgcacttaccggctcgcattagcgct
gatgacattcgaaacgaaaaaataaatgtgttaaaagcacttcgtccgcttgtaaaagaa
gagatggatctagacgttgttcgcggtcaatatgaggctggaaaaataaacggggcttca
gtgccgagctacataaatgagcccggtgtctcaccatcttcacagacagatacgttttta
gcagccagactatatatcgataattcgctttggaaaggcgttcctttctacattcgtaca
gggaaaagaatggcggaaaaagtgacgcgaattgttattgaattcaaagactcgctaaaa
gagttgtacttagacaaaggagaaacaacatctccaaatctgttgatcattgaaatcaac
ccgcacgaaaatattacgctgcagttaaacagcaaaaatccatttaatcatggtcatatt
gagcctgtacaaattaatttctcaggtcagcaagaaggagcgccggaagcatatgagcgt
cttattgcagatgcatgtgccggagattctacattttttgctcattggaaagaagtagag
ctagcttgggaatgggttcagccgcttcttgaagcgtttgaggaaaatacagtgccgctt
tataaatatgcagctggttcatacggccctgacgcatcatatgcacttttagaaaaagac
ggttttaagtggtggttggatgaagaaacagcaagtcaatcacgcgaagtgcagctagtt
taa

DBGET integrated database retrieval system