KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_2088Help
Entry
BG04_2088         CDS       T03825                                 

Gene name
phoD
Definition
(GenBank) alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00790  Folate biosynthesis
bmeg01100  Metabolic pathways
bmeg02020  Two-component system
Module
bmeg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BG04_2088 (phoD)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG04_2088 (phoD)
Enzymes [BR:bmeg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BG04_2088 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: AJI25166
UniProt: A0A0B6ANR9
Position
complement(1921477..1923237)
Genome map
AA seq 586 aa AA seqDB search
MENKSLNELIEQVKQNSFSSSKGFDRRRFLQGAGKVAGVSLGLTIAQSVGLNAVEVSAAA
PKFLSYPFTLGVASGDPLADSIVLWTRLAPDPLNGGGMPNQPIPVKWELSEDEDFHRIVK
RGTEVARPELAHSVHVDVKGLKPSHIYYYRFKSGHELSPVGKTKTLPSANEEVASMTFAF
ASCQQYEHGYFTAYEHMVKEQLDFVVHLGDYIYEYGPNEYVAASGNVRTHSSAEIQTLQD
YRNRHAQYRADANLKSAHAVFPWIVTWDDHEVENNYANVIPEKGQSVEAFIQRRAAAYQA
YYEHMPLRQTSLPHGADMRLYRDFSYGKLASFQVLDTRQYRDDQANGDGTKPQTPESLDP
KRTLLGNEQEKWLFTNLEKSACHWNVLAQQIFFAPRKFGTAAKPTYSMDAWDGYTANRQR
VIDFIEKKKLDNVIVLTGDVHANWASNLYADFANLNSRIIGAEFIGTSITSGGNGADKRA
DTDKILSQNPHLTFFNDYRGYVRCTVTPDIWQADYRVVPFVTEPGAEISTRASFQYKKDG
KGMTEVEVNNVPRGLKISKEVEEDRMRAHGKAHEKQELKKKEKVQQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaataaatcgttaaacgaattaatagagcaagtgaaacagaatagcttttcttcg
agtaaagggtttgatagacggcgttttttacaaggagctggaaaagtagcgggagtatca
cttggcttaacaattgctcagtctgttggtttaaatgcagtagaagtttcagctgcagcg
cctaaatttttaagttatccgttcactctaggcgtcgcatcaggagaccctttagcagat
agcattgttctttggacaagattagcaccagacccattgaatggcgggggaatgcctaat
caacctattccagtaaaatgggagcttagtgaagatgaagactttcatcgaattgtcaaa
cgaggaacagaagtggctagacctgaacttgctcattcggttcacgttgatgtaaaagga
ttgaagccgagtcatatttattattatcgatttaaaagcggccatgagttaagcccggtt
ggaaaaacaaaaacacttccttcagcaaatgaagaagtagccagtatgacgtttgcattt
gcttcgtgtcagcaatatgaacatgggtactttacagcctatgagcatatggttaaagaa
caattagattttgtcgttcatttgggcgattacatctatgaatatggaccaaacgagtac
gtggctgcaagcggaaacgttcgtactcacagcagcgcagaaattcaaacgctgcaagat
tatcgaaacaggcatgctcagtacagggcagatgccaatttgaagtctgctcacgctgtt
tttccatggattgtgacgtgggatgaccatgaagtagaaaacaattatgcaaatgtaatt
cctgaaaaaggccaatcagtagaagcatttattcaacgccgtgcggcagcttatcaagct
tattacgaacacatgcctttgcgtcaaacatccttgcctcacggagcggatatgagatta
tatcgtgacttttcatatgggaaattagcttcttttcaagtgttggatacgcgtcaatac
agagacgatcaagcaaacggagacggaacaaagccgcaaacgccagaatctcttgatccc
aaacgtacgctattggggaatgaacaagaaaaatggctgtttactaatcttgaaaagtca
gcgtgtcattggaacgtactggctcaacaaattttctttgcgccaagaaaatttggaacg
gctgctaagcctacatacagcatggatgcatgggatgggtatacggcgaatcgtcagcgc
gtcattgattttattgaaaagaaaaagttggacaacgtcattgtactaactggagatgta
cacgctaactgggcttctaacttatacgcggattttgctaaccttaattcaagaattatt
ggtgcagagttcatcggcacctccatcacttccggagggaacggagcagataaacgagca
gacacggataaaattttaagtcaaaatccacacctcacattttttaatgattatagagga
tatgtaaggtgtacggtaactcctgatatatggcaagccgattatcgcgttgtgcctttt
gtaacagagcctggtgcagaaatttcaactcgagcttcctttcaatataaaaaagatgga
aaaggtatgacggaagttgaagtaaataacgtgccgcgtggactaaagatttctaaggaa
gtagaggaagatcgtatgcgggcacacgggaaagcacatgaaaaacaagagttgaaaaag
aaagaaaaagttcagcagtaa

DBGET integrated database retrieval system