KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_2951Help
Entry
BG04_2951         CDS       T03825                                 

Gene name
pruA
Definition
(GenBank) putative delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00250  Alanine, aspartate and glutamate metabolism
bmeg00330  Arginine and proline metabolism
bmeg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BG04_2951 (pruA)
   00330 Arginine and proline metabolism
    BG04_2951 (pruA)
Enzymes [BR:bmeg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BG04_2951 (pruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJI25206
UniProt: A0A0B6ANW2
Position
2760629..2762176
Genome map
AA seq 515 aa AA seqDB search
MVVSYSHEPFTNFKDENNKKEFQEALTYVNTQLGKTYPLVIDGEKVETEEKITSVNPANI
KEVIGYVSTVNKDLAEQAMQSALKAFETWKKWKVEHRADILFRAAAIIRRRKHEFSSYLV
KEAGKPWNEADADTAEAIDFLEYYARQVLTLKDGSPVQSRDGEYNQYNYIPLGVGIIISP
FNFPLAIMAGTAVAAIVTGNTILLKPADATPVVAAKFVEVMEEAGLPKGVLNFIPGATPE
IGDYLVEHPKTRFVSFTGSRAVGCRIYERAAKVQPGQKWLKRVIAEMGGKDTVVVDKDAD
LDLAASSIVYSAFGFAGQKCSAGSRAVVHQDVYDEVLEKAVALTKTLTVGNPEEVSTYMG
PVIHEASYNKVLSYIEIGKEEGRLVAGGEADNSTGYFIQPTIFADVDEKARLMQEEIFGP
VVAFSKARDFDHMMEIANNTEYALTGALLSNNREHIERAREEFHVGNLYFNRGCTGAIVG
YQPFGGFNMSGTDSKAGGPDYLVLHMQAKTTSETF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtagtttcttattctcatgaaccatttacaaattttaaggacgaaaacaataaaaag
gaatttcaagaagcattaacatatgtaaatacacagcttggcaaaacatacccgcttgtg
atcgacggtgaaaaagtggaaactgaagagaaaattacgtctgttaacccagcgaatata
aaagaagtgattggatatgtctctacagtaaataaagatctagcagagcaagcgatgcag
tcagctttaaaagcttttgaaacgtggaaaaaatggaaagtagaacatcgcgcggatatt
cttttccgtgcagcggccatcatccgtcgcagaaagcatgaattttctagttatcttgta
aaagaagcaggaaagccttggaacgaagcagatgctgatacagcagaagcaattgatttt
ttagagtactatgcacgtcaagtcctgacgttaaaagatggttctccagtacagagtcga
gacggtgagtataatcagtacaattatattccgcttggcgtaggtattattatttcacca
tttaacttcccgttagctatcatggctggaacagcagtagcagctatcgtaacaggcaac
acgattttattaaagccagctgatgccactcctgtagtagcagcgaaatttgtagaagta
atggaagaagcaggtttaccgaaaggcgtattaaactttattcctggtgctacacctgaa
atcggtgactacttagttgaacatccaaaaacacgttttgtttcgtttaccggctcgcgc
gcagtaggttgccgcatttacgaaagagcagcaaaagtacagccgggccaaaaatggcta
aaacgcgttattgctgaaatgggcggaaaagatacggtggttgtagacaaagatgcggat
ctggatttagctgcttcttcaattgtatattctgcatttggttttgcagggcaaaagtgc
tccgctggttctcgtgctgttgtgcatcaagatgtgtatgatgaagtgcttgaaaaagca
gttgcgctaacaaaaacattaaccgttggaaacccggaagaagtttcaacttatatggga
cctgttattcatgaggcgtcgtataacaaagtattatcgtatattgaaattggaaaagaa
gaaggacggcttgttgcgggaggagaagcagacaattcaactggatactttattcagcca
actatttttgcggatgtagatgaaaaagctcgtctcatgcaagaagaaatttttggtccg
gtagtagcattctctaaagcgcgagattttgatcatatgatggagattgcaaacaataca
gaatatgcattaacaggcgctttattatcaaacaaccgcgagcatattgagcgcgctcgt
gaagagttccatgttggaaatctgtattttaacagaggatgtacaggagcgattgttggt
taccagccttttggcggatttaatatgtcaggaacggattcaaaagcaggcggaccggat
tatcttgttcttcacatgcaagcaaaaacaacatctgaaacattctaa

DBGET integrated database retrieval system