KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3348Help
Entry
BG04_3348         CDS       T03825                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase family protein
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BG04_3348
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmeg01011]
    BG04_3348
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmeg03036]
    BG04_3348
Enzymes [BR:bmeg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BG04_3348
Peptidoglycan biosynthesis and degradation proteins [BR:bmeg01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   BG04_3348
Chromosome and associated proteins [BR:bmeg03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BG04_3348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3
Motif
Other DBs
NCBI-ProteinID: AJI22106
UniProt: A0A0B6AF12
Position
3179800..3180675
Genome map
AA seq 291 aa AA seqDB search
MKRLVWSYGIGIVAIVAVLSFFFMMKGQTEKAVVSGNVPKAHAQGERVKQPISQFQAVQP
HEAGNEVKNVKNNMPEKADPPSFLVYIDPGHQSQANLEKEPIGPGSAETKIKVSGGTSGV
VTKKPEYKLTLEASMILKQLLEEKGITVKLTRSSDNVDISNRERAELANNSKADLHVRIH
ADGSENTSVKGFSVLTPTEDNSYTKSIYQSSLQASQAILTEVKKDQFVEVDGIRYRSDLS
GFNWSTVPVTLVELGYMTNPEEDRNLSDQAYLTKLMNHVADGIVAYEELKK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcttagtatggagttatggaataggtattgttgcaatagtagcagtactctca
tttttctttatgatgaaaggtcaaacagagaaagccgtcgttagcggaaatgtaccaaaa
gctcatgcgcagggagaaagagtgaagcagccgatctcacagttccaagcagtacagcct
catgaagcaggtaatgaagtgaaaaatgtaaaaaacaacatgcctgaaaaagcggatcct
ccttcttttttagtctacattgaccctggtcatcaatctcaagctaacctggagaaagag
ccaatcggaccgggatcagcagaaacaaaaataaaggtttccggaggcacatcaggcgta
gtgaccaagaagccggaatacaagctgacgttggaagcttctatgatattaaaacagctg
ctcgaagaaaaaggaataaccgtaaagcttactcgaagttctgataatgtagatatcagc
aaccgggaacgagcggagcttgcgaataattcaaaagctgatctgcacgtacgtatccat
gcagatggttctgaaaatacttctgtaaaaggattttctgtgctcactcctacagaagat
aattcctatacgaagtctatttaccaaagcagtttacaggcatctcaagctattctgaca
gaggtgaaaaaagatcagtttgtcgaagtggacggcattcgctatcgcagtgatctttca
ggatttaactggtcgactgtacccgtaacgctagttgaactggggtatatgacgaatcca
gaagaagaccggaacctgtctgatcaggcttaccttacaaagctgatgaatcatgttgca
gacggtatcgtggcatatgaagaattgaaaaaataa

DBGET integrated database retrieval system