KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_3354Help
Entry
BG04_3354         CDS       T03825                                 

Gene name
menC
Definition
(GenBank) o-succinylbenzoate synthase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00130  Ubiquinone and other terpenoid-quinone biosynthesis
bmeg01100  Metabolic pathways
bmeg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BG04_3354 (menC)
Enzymes [BR:bmeg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     BG04_3354 (menC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N Enolase_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: AJI23787
UniProt: A0A0B6ARK9
Position
complement(3188349..3189458)
Genome map
AA seq 369 aa AA seqDB search
MKIKRVILRHLKMDLLHPFTTSLGKEVDRDFILVEIQDEDGRSGWAESVACADPFYKEET
LKTNWHIMEDFLIPLLQQKEIQHPDEVSQRFAHIRGNYMAKAALEGAVWDLYARRQNLSL
SKALGGSKSQIEVGLSVGIQPTIDETLRKIEAGLNEGYKRIKIKIKPGWDLNLTRAVRHE
FPSIPLMVDANSAYTLADADHLAQLDEFDLMMIEQPLAHDDLIDHAELQVRMRTPICLDE
SIHSSEDVRKAIKLGSTQIINIKIGRVGGLTEAKKIHDLCQTHDMPVWCGGMLESGIGRA
HNIAITTLANFTLPGDTAASSKYWPRDIIHPEITVDNGIISVPDTPGIGYEPDHDQIKAL
TLHEKVYTC
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaaacgcgttattttacggcatttaaaaatggatttacttcatccgtttacg
acaagccttggaaaagaagtggatcgagattttattttagtagaaattcaagacgaagac
ggacgatccggctgggctgaatccgtagcgtgcgcggatcctttttataaagaagaaacg
ctcaaaacaaactggcacattatggaggattttttaattcccttgcttcaacagaaagaa
attcagcaccctgacgaagtatcccaacgctttgctcatattcgcggcaattacatggca
aaagcggcgttagaaggcgcagtttgggatttgtatgcgcgcaggcaaaacctctctcta
tctaaagcgctaggaggcagtaaaagtcaaattgaagttggtctcagcgttggcattcag
cctacgattgacgaaacgcttcgcaaaattgaagccggattaaatgaaggatataagcgg
atcaaaattaaaattaagccgggctgggatcttaacttgacgcgcgcggttcgacacgag
ttcccttctattccgctgatggttgatgcgaactctgcttatacgcttgcagatgctgat
caccttgctcagcttgatgagtttgatttaatgatgattgaacagccgttggctcatgat
gatttaattgatcacgctgaactgcaggtccgcatgcgcacgcccatttgcttagacgaa
agcattcattcatctgaagacgttcgaaaagctattaaacttggaagcacacaaattatt
aacattaaaattggacgagtaggcggactaacagaagccaaaaaaattcatgacctttgt
caaactcacgatatgcccgtatggtgcggcggtatgctcgaatcaggtatcggacgagca
cataatattgccattaccacacttgccaattttacgcttccgggagatacagctgcatcc
tctaaatactggccgcgtgatatcattcatccggaaataacggtcgacaacggtattatt
tccgttcctgatacaccaggcatcggctacgaacctgaccacgatcagataaaagcgcta
actttacacgaaaaagtctatacttgctaa

DBGET integrated database retrieval system