KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_4285Help
Entry
BG04_4285         CDS       T03825                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00480  Glutathione metabolism
bmeg00590  Arachidonic acid metabolism
bmeg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BG04_4285
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BG04_4285
Enzymes [BR:bmeg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BG04_4285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA FERM_F1 DUF823
Motif
Other DBs
NCBI-ProteinID: AJI25354
UniProt: A0A0B6AZJ6
Position
4132793..4133269
Genome map
AA seq 158 aa AA seqDB search
MSVYEYSAKTIKDEDVSLSNYQGDVLLIVNTASKCGFTPQYKDLQALYEEEKENGLTVLG
FPCNQFGGQEPGSSNDIEQFCELNYGVSFPMFAKVDVKGEHAHPLFTYLAEQAPGLLGSK
GIKWNFTKFLVNRQGEVVKRYAPQTAPKDIQKDIKELL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgtatgaatactctgcaaaaacaattaaagacgaagacgtatcgctatctaac
tatcaaggtgacgtgctgttgattgtgaatacagctagcaaatgcggcttcacccctcaa
tataaagatttgcaggcgctgtacgaagaagaaaaagaaaatggcctaacggttttaggt
tttccttgcaatcagttcggtggtcaagagccaggaagttcaaatgatattgaacaattt
tgtgagttaaactatggcgtttcgtttccgatgtttgcaaaagtagatgtaaaaggggag
cacgcacacccgttatttacatacttagcagaacaagcaccgggcctgctaggttccaaa
gggataaaatggaattttacaaagtttttagtgaatcgtcaaggtgaagtcgtgaagcga
tacgcacctcaaactgcaccaaaagatattcaaaaagatataaaagaattgctgtaa

DBGET integrated database retrieval system