KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_4728Help
Entry
BG04_4728         CDS       T03825                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00061  Fatty acid biosynthesis
bmeg00071  Fatty acid degradation
bmeg01100  Metabolic pathways
bmeg01212  Fatty acid metabolism
bmeg02024  Quorum sensing
Module
bmeg_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BG04_4728
   00071 Fatty acid degradation
    BG04_4728
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BG04_4728
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmeg01004]
    BG04_4728
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmeg04147]
    BG04_4728
Enzymes [BR:bmeg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BG04_4728
Lipid biosynthesis proteins [BR:bmeg01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BG04_4728
Exosome [BR:bmeg04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BG04_4728
  Exosomal proteins of breast cancer cells
   BG04_4728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C TTC5_OB AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AJI22144
UniProt: A0A0B6AQL9
Position
4550380..4551996
Genome map
AA seq 538 aa AA seqDB search
MEDVKKWFTPYPEAYTHDIHIEDISLFDMLKETAERYPAHTATRMYQHTLTYQELYHSVR
VFAGALQKKGIKKGDRVAIMLPNCPQYIISYFGIAAAGGIVTQVNPMLVEQELEHILNDS
GAKKIILLDDFYTRLQEIRNRVDIEEAITVSLQKPFVPASTDLSFLDFLTIKHEFNQPVI
HPAHDIAVLQYTGGTTGPSKGAMLTHTNIYTNAVQSYEIFKHDIELGKEKCLTVIPLFHV
FGMTSCMHLSILCGNEILLLPRFDLKEVLNTIKKEQPSIFPGVPTMYVAITNHPQAEEYN
IESIRICNSGSAPMPVELMKEFERKTGAKVLEGYGLSEASPVTHCNLPFCERKPGTVGLG
VPQTAYKIVDVATGTKELPRGELGEIVIKGPQVMKGYWNQPEETAHALRNGWLYTGDIGQ
IDEDGYLSIVDRKKDMIIASGFNVYPRDIEEVLYEHSHIKEAVVIGVPHPYRGETIKAIL
VVKEGKSLSKEELTSYCRQHLAAYKIPRIFEFRAELPKTNVGKILRRALREEVVKETM
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgttaaaaaatggtttacaccttatccagaagcctatactcacgacattcac
atcgaagacatttcactatttgatatgctgaaagaaacagccgaacgttatcctgctcat
acggcaacacgcatgtatcagcatacgctaacgtaccaggagctgtatcattcagttcgc
gtatttgcaggagcactacagaaaaaagggattaaaaaaggagatcgtgtagcaattatg
ctgccaaactgtccgcaatatataataagctatttcggcattgcagcagcgggcggcatt
gttactcaggtcaatcctatgcttgtcgaacaagagctagagcatattttaaacgattcc
ggggcaaaaaaaataattctgctcgatgatttttatacgagacttcaagagataagaaac
cgcgttgatatagaagaagcgataactgtaagcttgcaaaaaccttttgttcctgcatca
acagacctttccttcctagattttttaaccataaaacatgaatttaatcagccggtcatc
cacccagcacacgatattgctgttcttcagtatacgggaggaacgaccggaccatctaaa
ggtgcgatgcttacacatacaaacatttacacaaacgcagttcaatcatacgaaatattt
aagcatgatattgaattaggaaaagaaaaatgcttaaccgttattccattatttcatgta
tttggtatgacttcctgtatgcatttatcgattctttgcggaaatgaaatattgctattg
ccgcgttttgatttgaaagaagtattaaatacaataaaaaaagagcagcctagtattttt
cctggtgtgccaactatgtatgtcgcgattaccaatcatcctcaggcagaagaatacaac
attgaaagtattcgcatctgcaacagcggcagtgcaccgatgcctgttgagctgatgaaa
gagttcgaacgaaaaacgggtgctaaagtgttagaagggtacggcttatcagaagcgtcc
cccgtgacgcattgcaacctgccgttttgtgagagaaagccgggtactgtcggacttggc
gttccacaaactgcttataaaattgtagacgtggctaccggaacaaaagaactgccaaga
ggagagcttggagaaatagtaattaaagggcctcaagttatgaagggctattggaatcaa
cctgaagagacggctcacgcgcttagaaacggctggctgtacacgggagatattggacag
atagatgaagacgggtatttatccattgttgatcgcaaaaaagatatgattattgcgagt
ggttttaatgtgtaccctcgagatattgaagaagttttatacgaacacagccacattaaa
gaagccgttgtaattggtgtgccgcatccttacagaggagaaaccattaaagcgattttg
gtagtgaaagaagggaaatctctttccaaagaagagcttacttcttattgtcgacagcac
cttgcagcttataaaattccgcgaatctttgagtttcgcgctgagcttcctaagactaat
gtagggaaaattttacgacgggcactacgagaagaagtggtgaaagaaacgatgtaa

DBGET integrated database retrieval system