KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_4944Help
Entry
BG04_4944         CDS       T03825                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00071  Fatty acid degradation
bmeg00072  Synthesis and degradation of ketone bodies
bmeg00280  Valine, leucine and isoleucine degradation
bmeg00310  Lysine degradation
bmeg00362  Benzoate degradation
bmeg00380  Tryptophan metabolism
bmeg00620  Pyruvate metabolism
bmeg00630  Glyoxylate and dicarboxylate metabolism
bmeg00640  Propanoate metabolism
bmeg00650  Butanoate metabolism
bmeg00900  Terpenoid backbone biosynthesis
bmeg01100  Metabolic pathways
bmeg01110  Biosynthesis of secondary metabolites
bmeg01120  Microbial metabolism in diverse environments
bmeg01130  Biosynthesis of antibiotics
bmeg01200  Carbon metabolism
bmeg01212  Fatty acid metabolism
bmeg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG04_4944
   00630 Glyoxylate and dicarboxylate metabolism
    BG04_4944
   00640 Propanoate metabolism
    BG04_4944
   00650 Butanoate metabolism
    BG04_4944
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BG04_4944
   00072 Synthesis and degradation of ketone bodies
    BG04_4944
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BG04_4944
   00310 Lysine degradation
    BG04_4944
   00380 Tryptophan metabolism
    BG04_4944
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BG04_4944
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BG04_4944
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BG04_4944
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmeg04147]
    BG04_4944
Enzymes [BR:bmeg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BG04_4944
Exosome [BR:bmeg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BG04_4944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJI24110
UniProt: A0A0B6AGU3
Position
4751050..4752144
Genome map
AA seq 364 aa AA seqDB search
MYQAVIVKAKRTVIGKENGILKGFHVQELTAPLLKHLSAGIEHEIDDIILGNVVGPGGNA
ARLSALEADLPFSIPGMTIDRQCGAGLEAIRMASYLIKAGAGTCYLAGGVESTSTSPFEK
RARFSPDKIGDPDMGIAAENVAQRYNISKDQQDRYALLSHERSWEAFEKRLFEEETLPLP
NVMHDEAFMKKRNLTKLLQKASPVFLKKEGTVTAANSCGINDGACITLVIEEQKARSLGF
QPVLRFIDADISGVSPLYPAIAPVSAIKNILKRNSLTVDDIDLFEINEAFAVKVVSCMQE
LGIREEKVNIRGGALTLGHPYGASGAILATRLFYESKRRDMRYVIAALGSGGGIGTAVLF
EVIK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaagcagtaattgtgaaagcgaagcgtacggtcattggaaaagaaaacggtata
ctgaaaggttttcatgttcaagagctaacggcccctttattaaaacaccttagcgctgga
attgaacatgaaattgatgacattattttagggaatgttgtaggtccaggaggaaacgca
gctaggctatccgctttagaagcagacctccctttttctatcccgggaatgaccattgat
cgtcagtgcggagctggcttagaagcgattcgaatggcgagctatttaataaaagcaggc
gctggaacgtgttatttagctggaggcgttgaaagtacaagtacttctccttttgaaaaa
agagcacgtttttctcctgataaaattggtgaccctgacatggggatcgcagcagaaaac
gtagctcagcgatacaatatatctaaagatcagcaggacagatatgctcttttaagtcat
gaaagaagctgggaggcttttgaaaaaaggttgtttgaagaagaaacgcttcctcttcca
aacgtgatgcacgatgaagcatttatgaaaaaacgaaacctaacaaagctgctgcaaaaa
gccagccccgtctttttaaaaaaagaaggcaccgtcactgcagcaaacagctgtggaatt
aacgacggagcctgcattacacttgtgatagaagagcaaaaagcacggtccttaggcttt
cagcccgttttgcgttttattgacgctgatatttcaggagtgtcacctctttaccctgct
attgcaccagtttctgcgattaaaaatatcttgaagcgaaattctcttacggtagatgat
attgacttatttgaaatcaatgaagcatttgctgttaaagttgtctcttgcatgcaagaa
ctgggaatacgagaagagaaagtgaatattcgcggaggagcattgactctaggacaccca
tacggagcatcaggagctattttagctacgcgtcttttttatgaaagcaagcgccgtgac
atgcgatatgtcatagcggctttaggaagcggaggcggaataggaacagcggtattattt
gaagtaatcaaataa

DBGET integrated database retrieval system