KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_5398Help
Entry
BG04_5398         CDS       T03825                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Pathway
bmeg00620  Pyruvate metabolism
bmeg00630  Glyoxylate and dicarboxylate metabolism
bmeg01100  Metabolic pathways
bmeg01110  Biosynthesis of secondary metabolites
bmeg01120  Microbial metabolism in diverse environments
bmeg01200  Carbon metabolism
Module
bmeg_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG04_5398 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BG04_5398 (glcB)
Enzymes [BR:bmeg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BG04_5398 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AJI25171
UniProt: A0A0B6ANS5
Position
complement(5162640..5164817)
Genome map
AA seq 725 aa AA seqDB search
MTNYKQVGNLKVAPVLYQFINEEAIPGSGLSTENFWSDFEALVTKLTPVNKRLLEKRDQL
QAQINAWHQENPDGDFSEYKSFLTRIGYLEGKTEDFLIGTEGVDSEIAYQAGPQLVVPVN
NARYAINAANARWGSLYDALYGTDAISEENGASRTSSYNPIRGEKVIAFAKNFLNEVVPL
VQSSHAEVVQYSLENGKLVAQLNDGSLTELQEEEKFVGYQGEEESPDALLFKNNGLHFEV
QIDRTDSIGKTDDAGVKDILMEAALTTIMDCEDSVAAVDAEDKVDVYRNWLGLMKGDLTS
TFKKGSQNMTRRLNPDRTYISPDKKKISLSGRSLMFVRNVGHLMTNSAVLDRNGNEIYEG
ILDSVITSLIAKHTLLKNGTYQNSKKSSIYIVKPKMHGSKEVAFANTLFNSIEDMLGLER
HTIKIGVMDEERRTTLNLKACIKEVKERVAFINTGFLDRTGDEIHTSMEAGAVIRKNDMK
TSKWLQGYEQSNVNVGLASGFQGRAQIGKGMWAMPDMMAEMLKQKVGHLKAGANTAWVPS
PTAATLHALHYHQIDVRDVQNELLTQSTDLQDDILQIPVAEKPNWSKDEIQQELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISSQHVANWLHHGICTKEQVTETLKR
MAKVVDQQNENDPLYQPMAPNYSASIAFQAACDLVFQGYDQPNGYTEPILHRSRIEAKAK
AAIKQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaactataaacaagttggaaatctgaaagtagctccagttctctatcaatttatc
aatgaggaagctattccgggcagcggcctaagtacagaaaatttttggtctgattttgaa
gcgttagtaaccaagttaacacccgtaaataaacgtttgttagaaaagcgtgatcagctg
caagctcaaattaatgcgtggcatcaagaaaaccctgacggtgactttagcgaatacaaa
tcgtttttaacgagaattggctatttagaaggcaagacagaagattttcttattggtaca
gaaggagtagacagcgaaattgcctatcaggcaggaccacagcttgttgtaccagtaaat
aacgcccggtacgctattaacgctgctaatgcacgttggggaagtctctatgatgctctt
tacggtactgatgcaatcagtgaagaaaatggagcttcgcgcacgagttcttataatcca
attcgaggagaaaaagttattgcgtttgcgaagaattttcttaatgaagttgttccgctc
gttcagtcttctcatgcggaagtggttcagtacagccttgaaaatggaaagcttgtcgct
caattaaacgatggcagtttaaccgaattacaggaagaagagaaatttgtagggtatcaa
ggggaagaagaaagccctgatgctcttttattcaaaaacaacggcctgcattttgaagtt
caaattgaccgtacggattcgattggtaaaacagacgatgcgggtgtaaaagatatttta
atggaagcagctcttacgacgattatggactgtgaagattcagtagcggcagtagacgca
gaagataaagtagatgtttaccgcaactggctgggattaatgaaaggtgatttgacgtct
acttttaaaaaaggaagtcaaaacatgacaaggcgtttaaatccagaccgtacctatatt
tctccggacaagaaaaagatttcactgtctggccgttcgcttatgtttgttcgaaacgtt
ggacatttaatgacaaacagcgctgttttagatcgaaatggcaacgaaatctatgaaggt
attttagacagcgtgattactagtttaattgccaaacacaccttgcttaaaaacggtacg
tatcaaaattctaaaaagagctctatctatatcgttaaaccgaaaatgcacggctccaaa
gaagtagcttttgccaatacgctatttaattcaattgaagatatgctagggcttgagcgt
catacaattaaaattggcgtaatggacgaagagcgccgcacgacgcttaatttaaaagcg
tgtatcaaagaagtaaaagaacgagtggcttttattaatactggattcttggatcgaacg
ggtgacgaaattcatacctcaatggaagcgggcgctgttattcgtaaaaatgatatgaaa
acgtctaaatggcttcaaggctacgagcagtctaatgtaaatgtaggattagcaagcgga
ttccaagggcgcgctcaaatcggaaaaggaatgtgggcaatgccggatatgatggcggaa
atgcttaaacaaaaagtaggacatttaaaagcaggagcgaatacggcatgggtgccttca
ccaaccgcagcaacgcttcatgctcttcactatcatcaaattgatgtaagagatgttcaa
aacgaattgcttactcagtctactgatttacaagatgacattttgcaaattcctgtggca
gaaaaaccaaattggagcaaagatgaaattcagcaggagctcgacaacaacgctcaagga
atacttggttatgtagtaaggtgggtcgaccaaggagtagggtgttcaaaagtaccggat
attaataatgtagggctaatggaagaccgggcaacgcttcgtatttctagtcagcacgta
gctaactggcttcatcatggaatttgtacaaaggaacaagtaacggagacgctcaagcga
atggcaaaagtagtggatcaacaaaatgaaaatgatcctctgtatcagccaatggcaccg
aactacagcgcatccattgcttttcaagcagcctgcgatttagtatttcaaggctacgat
cagccaaacggctatacggagcccattttacaccgcagccgtatagaagcaaaggcaaaa
gcagctataaaacagtaa

DBGET integrated database retrieval system