KEGG   Brucella melitensis bv. 1 16M: DK63_2960Help
Entry
DK63_2960         CDS       T03831                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel00010  Glycolysis / Gluconeogenesis
bmel00053  Ascorbate and aldarate metabolism
bmel00071  Fatty acid degradation
bmel00280  Valine, leucine and isoleucine degradation
bmel00310  Lysine degradation
bmel00330  Arginine and proline metabolism
bmel00340  Histidine metabolism
bmel00380  Tryptophan metabolism
bmel00410  beta-Alanine metabolism
bmel00561  Glycerolipid metabolism
bmel00620  Pyruvate metabolism
bmel00625  Chloroalkane and chloroalkene degradation
bmel00903  Limonene and pinene degradation
bmel01100  Metabolic pathways
bmel01110  Biosynthesis of secondary metabolites
bmel01120  Microbial metabolism in diverse environments
bmel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK63_2960
   00053 Ascorbate and aldarate metabolism
    DK63_2960
   00620 Pyruvate metabolism
    DK63_2960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK63_2960
   00561 Glycerolipid metabolism
    DK63_2960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DK63_2960
   00310 Lysine degradation
    DK63_2960
   00330 Arginine and proline metabolism
    DK63_2960
   00340 Histidine metabolism
    DK63_2960
   00380 Tryptophan metabolism
    DK63_2960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DK63_2960
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DK63_2960
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DK63_2960
Enzymes [BR:bmel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DK63_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AIJ88384
Position
2:complement(922200..923633)
Genome map
AA seq 477 aa AA seqDB search
MLHYGNFIAGQWQDAVGGEHITLKNPSDGSDLALIARGAKADIDLAVVAARSALSGDWGK
LTATERGRILHRISEEVLKNIDLLTDLESKDVGKPVTQARVDVVALARYLEFYGASADKV
HGDTLPYQNGFTVLSIYEPHGVTGHIIPWNYPMQILGRSLGAALAMGNAAVVKPAEEACL
TILEFARIAEKAGLPKGALNVVTGFGAEAGAALCEHPDVNHISFTGSVRTGEVVQAAAAK
NTVPVTLELGGKSPQIVFADADLDRALPFLVNAGIQNAGQTCSASSRILVERSIYEEVIA
RMSERYRALKVGPASADLSVGPVVSQRQKAIVDGYLDLAKESGLAIAAQGVLAEGAPEGG
AYVLPTLIRDVPADHRLAQEEIFGPVQVILPFDTEEEAIANGTHYGLVCGIWTNDGGRQF
RLAHAIHSGQVFINNYGAGGGIELPFGGVKKSGHGREKGFEALYGFASLKTISVYHG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
ttgcttcattatggcaatttcatcgcgggccagtggcaggatgccgttggcggcgagcat
atcacactcaagaatccttccgatggcagtgatctggcgctgattgcacgcggcgccaag
gctgatatcgatctggccgtcgtggcggcccgtagcgcgctttccggtgactggggcaag
ctgacggcaaccgagcgcggccgcatcctgcaccgcatttcggaagaagtgctgaagaat
atcgatctgctgacggatctggaatcgaaggatgttggcaagcccgttacacaggcgcgt
gtcgatgtggtggcgctggcgcgttatctcgaattctacggtgcttccgccgacaaggtg
catggcgatacgctgccttatcagaacggtttcacggttctgtcgatctacgagccgcat
ggtgtcacaggccacatcattccgtggaactatccgatgcagattctgggccgcagcctt
ggtgccgcactggccatgggcaatgcggcggtggtgaaacctgccgaagaagcttgcctc
accattctggaatttgccaggatcgcggaaaaggctggcctgcccaaaggtgcgctcaat
gtcgtcacgggatttggtgcggaagccggtgcggcgctctgcgaacatcccgatgtcaac
catatttcgtttaccggctccgttcgcactggcgaggtggttcaggcggcggcagcaaag
aacaccgtgccggtgacactggaactgggcggcaagtctccgcagatcgtctttgccgat
gccgatctcgaccgtgccttgccgtttctggtcaatgcgggcatccagaatgccggtcag
acctgttctgcttcgtcgcgtattctggtcgagcgcagtatttatgaagaagtcatcgcg
cgcatgagcgagcgttaccgggcgctgaaagtcggtccggccagtgccgatctttctgtc
ggtcctgtcgtgtcacagcgccagaaggcgattgtggatggctatctcgatctggcgaaa
gaaagcgggctcgccattgccgcgcaaggtgtgctggcagaaggcgcgccggaaggcggg
gcctatgtcctgccgacgctgatccgtgatgtgcctgccgatcatcgtctggcgcaggag
gaaatttttggccccgtgcaggtgatcctgcctttcgacacggaagaagaagccatcgcc
aatggtacgcattatggcctcgtctgtggtatctggaccaatgatggcggacggcagttc
cgcctcgcacatgccatccattccggtcaggtgttcatcaataattacggtgcggggggc
ggtatcgagctgccgttcggcggcgtgaagaaatccggccatggccgcgaaaaggggttt
gaggcgctctacgggtttgcctcgctgaagaccatttccgtctatcacggctga

DBGET integrated database retrieval system