KEGG   Brucella melitensis bv. 1 16M: DK63_494Help
Entry
DK63_494          CDS       T03831                                 

Definition
(GenBank) succinate CoA transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel00020  Citrate cycle (TCA cycle)
bmel00620  Pyruvate metabolism
bmel00650  Butanoate metabolism
bmel01100  Metabolic pathways
bmel01110  Biosynthesis of secondary metabolites
bmel01120  Microbial metabolism in diverse environments
bmel01130  Biosynthesis of antibiotics
bmel01200  Carbon metabolism
Module
bmel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DK63_494
   00620 Pyruvate metabolism
    DK63_494
   00650 Butanoate metabolism
    DK63_494
Enzymes [BR:bmel01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     DK63_494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: AIJ89680
UniProt: Q8YH76
Position
1:complement(496980..498470)
Genome map
AA seq 496 aa AA seqDB search
MLEARIRNSSLRNKVITAEQAASFIKDGMIVGMSGFTRAGDAKAVPVAMAARAATDPFQI
TLITGASLGHDVDKLLTEAHILSRRMPFQADRTLRSAINRGEVMFIDQHLSETVEQLRSN
QIGPIDCAVVEALAITESGGIIPTTSVGNSASLAILAEKVIVEVNLNQPMALEGLHDIYI
PTKRPSRDPIPIMACDSRIGLPYIPIAPEKIAGIVITQENDSASPVEPADHETVAIAGHL
IEFFKGEVVKGRLDLALNPLQAGIGTIANAVLTGFADSPFHNLRMYSEVLQDSTFDLFDA
GKLDFASGSSITLSPACGERVFNNIDRYRDRLVLRPQEISNHPEVIRRLGIIGINTALEF
DIYGNVNSTHVDGTNMMNGIGGSGDFARNAYISIFVSKSEAKNGAISSVVPMVTHVDHTE
HDVDILVTEQGLADLRGLAPRERAPVIIENCAHPDYRDQLMDYYERACKRGGHTPHLLEE
AFSWHLRRQENGSMRK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagcacgtatccgtaacagttcactgcgaaacaaggttatcactgcggagcaa
gcggcaagctttatcaaggatggcatgattgttggcatgagcggctttacgcgcgcgggc
gatgccaaggccgttccggtcgccatggccgcgcgggcggcaaccgatccattccagatc
accctgattacaggggcctccctcggacatgacgtcgataaactgttgaccgaagcgcat
attctttctcgccgtatgccgtttcaggccgaccgcacattgcgcagcgcgatcaaccgc
ggcgaagtcatgtttatcgaccagcatctttccgaaacagtcgagcaacttcgttccaac
cagatcggccccatcgactgtgccgtggtagaggcattggcgattaccgaaagcggcgga
atcatcccgacgacttcggtcggcaattcggccagcctcgccattcttgccgaaaaggtt
atcgtcgaggtcaatctgaaccagcccatggcgctggaaggcctgcacgatatttatata
ccgacgaagcgcccttcccgcgatcctatcccgatcatggcttgcgatagccggatcgga
ctgccctatattcccatcgcgccggaaaaaatcgccggtatcgtcatcacgcaggaaaat
gacagtgcgtcacctgtcgagcccgcagatcacgaaacggttgcgattgccgggcatctg
atcgaattcttcaagggggaagtcgtaaagggtcgtctggatctggcgcttaatccattg
caggcgggcatcggcaccattgccaatgcggttttgaccggctttgcagatagtcctttc
cacaatctgcgcatgtatagcgaggtattgcaggatagcacgttcgatctgttcgatgcg
ggcaagctggattttgcctccggctcatcgatcactctcagccccgcttgcggcgagcgc
gttttcaataatatagaccgctatcgtgacaggcttgtcctgcgcccgcaggaaatcagc
aaccatccggaagtcatccgccgtcttggtattatcggcatcaataccgcactcgaattc
gatatctacggcaacgtcaactcaacccatgttgatggaaccaatatgatgaacggcatt
ggcggttccggcgattttgcgcgcaacgcctatatttcgatcttcgtcagcaagtcggaa
gccaagaatggcgcgatctcctcggtcgtgcccatggtaacacatgtggaccacacggaa
catgacgtggatatcctcgtgacggaacagggacttgccgatttgcgcgggcttgcacca
cgcgagcgagcgcccgttatcattgaaaattgcgcacatcccgattaccgggaccagctc
atggattattacgagcgagcctgcaaacgcggcggccacacgcctcatcttctggaagag
gcattcagttggcacctgcgccgtcaggaaaatggcagtatgcgcaaataa

DBGET integrated database retrieval system