KEGG   Brucella melitensis bv. 1 16M: DK63_750
Entry
DK63_750          CDS       T03831                                 

Gene name
secD
Definition
(GenBank) export membrane protein SecD
  KO
K12257  SecD/SecF fusion protein
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel02024  Quorum sensing
bmel03060  Protein export
bmel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    DK63_750 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DK63_750 (secD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DK63_750 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmel02044]
    DK63_750 (secD)
Secretion system [BR:bmel02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   DK63_750 (secD)
SSDB
Motif
Pfam: SecD_SecF Sec_GG ACR_tran MMPL SecD-TM1 Sterol-sensing SspB
Other DBs
NCBI-ProteinID: AIJ88800
UniProt: Q8YHW6
Position
1:754245..756782
AA seq 845 aa
MRTSKWVVALYSLVVLIGIIIALPNFFTQKQLDALPSWLPKRQVTLGLDLRGGSYLVLEV
DAAALKKDRLRTLLDDARSKLRADRIQPQSIRVVGDAVVVTIPDADQRAKAETALRTLIS
QVNTSGFGTAINDIDVTENDNNQIRLTLTEAGFNYRLDSALQQSLEIIRQRVDQVGVAEP
SIQRVGSDRIVVQLPGLQDPAQLRQLLGSTAKMSFHMVADANPNDPPPPGVTIMPDSKNP
AIKYPIEDQVALSGERLTDARAGFDPRTNEPIVSFRFDSLGARQFADITTKNVNRPFAIV
LDGKVLSAPVIREPITGGSGQISGSFTVQDTVVLSALLRAGALPAPLTVIEERTVGPDLG
GDAIKMGLMTGIIGFLLVAVFILLLYGFWGVIANVALLLHTLLTFSALSLIGATLTLPGI
AGIILGIGIAVDANILINERIREETRKGLGAMAALDKGFHSAFATIVDANVTTLTATILL
FLFGTGPVRGFAVTMMLGIAISMFTDVTLVRMIMAWFVRRRKLKVLHIEPFLKFVPEHTN
FRFMNARFIGIGVSIVLSIASIILFFKPGLNYGIDFKGGIQAEISTSQPADLAQLRAKLG
ALNLGEVALQTAGSPNQVLIRVQRQEGGEEAQTAAINKMREAVTELDPGVKIERTEVVGP
KVSGELARSGMIAVILSAVVMLFYIWWRFEWFFALGAIATLILDTTKIIGFFALTQLDFN
LTAIAALLTIIGYSVNDKVVVYDRMRENMRLYKSKTLREIIDMSINQVLVRCIYTSMTTF
LCMFPMAIWGGSAVHNFAVPMLFGIVIATSSSIFIAAPILLLLGDWWQRHKAAHKTAEEG
AIAQK
NT seq 2538 nt   +upstreamnt  +downstreamnt
atgcgtacttcaaaatgggtcgttgcgctttatagcctggtcgttctgatcggcataatc
atcgccttgcccaacttctttacccaaaagcaactggatgcgctgccatcatggctgccg
aagcgtcaggtcacactcggcctcgatctgcgcggcggctcctatctcgtactcgaagtg
gatgcggcagcactgaaaaaggatcgcctgcgcaccctgctcgacgatgcccgcagcaag
cttcgcgccgaccgcatccagccgcagtcgatccgcgtcgttggcgacgcggttgtcgta
accatccccgacgccgaccagcgcgccaaggccgaaacagccctgcgcaccctcatctcg
caggtgaacaccagcggctttggcacggcgatcaacgacatcgacgtcacggaaaacgac
aataaccagattcgcctgacgctgactgaggcaggcttcaattaccgcctcgattcagcc
cttcagcaaagccttgaaatcatccgccagcgcgttgaccaggttggcgttgccgaaccg
tccatccagcgcgtcggctctgaccgcatcgtggttcagcttccaggccttcaggatccg
gcacagctccgccagcttctcggaagcacggcgaagatgagcttccacatggtcgcggat
gccaatccgaacgatccgccgcctccgggcgtgaccatcatgccggattcaaaaaatccc
gccatcaaatatccgatcgaggatcaggtcgccctttccggcgagcgcctcaccgatgcg
cgcgcgggcttcgacccgcggaccaatgagcctatcgtttcgttccgtttcgacagcctc
ggtgcacgccagttcgcggatatcaccaccaagaacgtcaaccgccccttcgccatcgtt
ctcgacggcaaggtgctgagcgcgccggtcatccgcgagccgatcacgggcggctccggc
cagatcagcggcagcttcaccgttcaggatacggtcgtcctctccgcgcttctgcgcgca
ggcgccctgcccgctccgctcaccgtcatcgaagaacgcaccgtcggcccggatcttggc
ggcgacgccatcaagatgggcctgatgacaggtatcatcggcttccttctcgtggccgtc
ttcatcctgcttctctatggattctggggtgtgattgcgaatgtcgcgcttctgctccat
acgctgctgaccttctcggcgctaagcctgatcggcgcaacgctgacgctgcccggtatc
gcaggcattattctcggcatcggcatcgcggtcgatgcgaatattctcatcaacgagcgc
atccgtgaagaaacccgcaagggacttggcgcgatggcggcgctcgacaagggcttccac
agcgcctttgccaccatcgtggacgccaatgtcacgacgctgacggcaaccatccttctg
ttcctgttcggcaccggcccggttcgcggcttcgccgtcaccatgatgctcggcatcgcc
atttcgatgttcaccgatgtgacgctggtgcgcatgatcatggcgtggttcgtccgccgc
cgcaaactcaaggtgctgcacatcgagccattcctgaaattcgtgcccgagcatacgaat
ttccggtttatgaatgcgcgtttcatcggcatcggcgtttccatcgtgctgtcgattgcc
tcgatcatccttttcttcaagccgggcctcaattatggcatcgacttcaagggcggtatc
caggcagaaatcagcacctcacagccagccgatcttgcgcagcttcgcgccaagcttggc
gcgctcaacctgggtgaagtcgcacttcaaaccgctggcagccccaatcaggttctgatc
cgcgttcagcgtcaggagggtggcgaagaggcgcagacggcagccatcaacaagatgcgt
gaagccgtgaccgaactcgatcccggtgtgaagatcgaacgcaccgaagtcgtcggcccg
aaagtctccggtgagctcgcccgttcgggcatgatcgcggtcattctttcggctgtcgtc
atgctgttctatatctggtggcggttcgagtggttcttcgcgctgggggccatcgcgacg
ctcattctcgacaccacaaagatcatcggctttttcgccctgacacaactcgacttcaac
ctgaccgccattgccgcgctgctgaccattatcggttattcggtgaacgacaaggtggtc
gtctatgaccgcatgcgtgaaaacatgcgcctctacaagtcgaagacgctgcgcgaaatc
atcgatatgagcatcaatcaggtgcttgtgcgctgtatctacacgtcaatgacaactttc
ctgtgtatgttccccatggcgatctggggcggcagcgccgttcataattttgccgtgcct
atgctgttcggtattgtgatcgcgacgtcgtcttcgatcttcatcgcggcgccgattctg
ctgttgctgggcgactggtggcagcgtcacaaggcggcgcacaagacagccgaagaaggc
gcaatcgcgcagaaataa

DBGET integrated database retrieval system