KEGG   Brucella melitensis bv. 1 16M: DK63_929Help
Entry
DK63_929          CDS       T03831                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK63_929
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bmel02022]
    DK63_929
Two-component system [BR:bmel02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DK63_929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AIJ89248
Position
1:942408..943115
Genome map
AA seq 235 aa AA seqDB search
MAAEEEKTLSDDAPHLLVVDDDTRIRSLLSQYLTNSGFRVTMAGSAAEARRKLEGIDFDL
LILDVMMPGETGVSLTRSLREQKNVPILMLTALSETDSRIDGLAAGADDYLPKPFDPREL
TLRINNILRRGAPPAQPKIEQIVFGPYTFFIPRRELKKGTETIKLTDREQDIMAIFAERA
GETIPRHELTGQDGDVGERTIDVQINRLRRKIEQDPANPVWLQTVRGIGYKLSIE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaagaagaaaagacgctatcggacgacgcaccgcaccttctcgtcgtggac
gacgatacgcgcatccgcagccttctctcacaatatttgaccaatagcgggtttcgcgtc
acgatggctggcagtgcagccgaagcgcgccgcaagctggaaggcatcgacttcgacctt
ctgattctcgacgtgatgatgccgggagaaaccggcgtttcgctgacgcgctccttgcgc
gaacagaagaacgtgccgattctcatgctgacagccctgtcggaaaccgacagccgcatc
gacggcctggctgccggagcagacgactatctgcccaaaccctttgatccgcgcgagctg
acactgcgtatcaacaatatcctgcgccgtggcgcaccgcccgcgcagccgaagatcgaa
cagatcgtgttcggcccttatacttttttcattccgcgtcgcgaattgaagaagggaacc
gagacgatcaagctcaccgaccgcgagcaggatatcatggcgatctttgccgagcgggcg
ggcgaaaccatcccccgccatgaactgaccgggcaggacggcgatgtgggtgaacgcacg
atcgatgtgcagatcaaccgtctgcgccgaaagatcgagcaggatcccgcaaacccggtc
tggctccagaccgtgcgcggcatcggctacaaactcagcatcgaatag

DBGET integrated database retrieval system