KEGG   Bacillus methanolicus: BMMGA3_00720Help
Entry
BMMGA3_00720      CDS       T03209                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bmet  Bacillus methanolicus
Pathway
bmet03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BMMGA3_00720 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bmet03011]
    BMMGA3_00720 (rplV)
Ribosome [BR:bmet03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BMMGA3_00720 (rplV)
  Bacteria
    BMMGA3_00720 (rplV)
  Archaea
    BMMGA3_00720 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TINF2_N
Motif
Other DBs
NCBI-ProteinID: AIE58647
UniProt: I3E427
Position
140384..140725
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVVDLIRGKQVGEAVAILKHTPKAASPIVEKVLKSAVANAEH
NYEMDVNNLVVSQAYVNEGPTLKRFRPRAMGRASQINKRTSHITIVLSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagttcgtattgctcctcgtaaagctcgtttagtt
gtagatctaattcgaggaaagcaagttggtgaagcggtggcaattttaaaacacactcca
aaagctgcttctccgatcgtagaaaaagtattgaaatctgctgttgctaacgcagaacat
aactacgaaatggacgttaataatctcgttgtatctcaggcttacgtaaacgaagggccg
acattaaaacgtttccgtcctcgtgcaatgggacgtgcaagccaaattaacaaacgtaca
agtcacattacaatcgttttatcagaaaagaaggagggataa

DBGET integrated database retrieval system