KEGG   Bacillus methanolicus: BMMGA3_01840Help
Entry
BMMGA3_01840      CDS       T03209                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00071  Fatty acid degradation
bmet00072  Synthesis and degradation of ketone bodies
bmet00280  Valine, leucine and isoleucine degradation
bmet00310  Lysine degradation
bmet00362  Benzoate degradation
bmet00380  Tryptophan metabolism
bmet00620  Pyruvate metabolism
bmet00630  Glyoxylate and dicarboxylate metabolism
bmet00640  Propanoate metabolism
bmet00650  Butanoate metabolism
bmet00900  Terpenoid backbone biosynthesis
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01120  Microbial metabolism in diverse environments
bmet01130  Biosynthesis of antibiotics
bmet01200  Carbon metabolism
bmet01212  Fatty acid metabolism
bmet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMMGA3_01840
   00630 Glyoxylate and dicarboxylate metabolism
    BMMGA3_01840
   00640 Propanoate metabolism
    BMMGA3_01840
   00650 Butanoate metabolism
    BMMGA3_01840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMMGA3_01840
   00072 Synthesis and degradation of ketone bodies
    BMMGA3_01840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMMGA3_01840
   00310 Lysine degradation
    BMMGA3_01840
   00380 Tryptophan metabolism
    BMMGA3_01840
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMMGA3_01840
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMMGA3_01840
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMMGA3_01840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmet04147]
    BMMGA3_01840
Enzymes [BR:bmet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMMGA3_01840
Exosome [BR:bmet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMMGA3_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIE58838
UniProt: I3E3L6
Position
344124..345290
Genome map
AA seq 388 aa AA seqDB search
MATVILEGVRTPFGKFRGKLADVTAKQLGTIAVKELLRRIPEAKKADGVLLAQVIQAGEG
QNPARKVAVEAGVDLSVPAITLNNVCLAGLASVADAARRIALQEGQLYIVGGYDSMTNAP
HIANLRKSVTLGKAEFTDTLINDGLWCSLSNELMGVLTDKKNKELGITRKEQDEFACLSQ
QRAFSALKESRLQEEITPVYVNEELVKEDEGIRPNTTIEGLAKLRPVFTEDGTITAGNAS
QMSDGASAGIVASETLAEKLGYTPLARIIGWADIAGPDTSLHLKPAQAIEKVLEKTGLSV
NDIDLFEINEAFASVAIASCKKLRIPFEKVNVNGGAIAIGHPLGGTGFRLLLTLVHELRR
RGGGKGIAALCGGGGQGTAVLVEVPERW
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgttattttagaaggagtccgcaccccatttggaaagtttagaggaaaactg
gcagatgtaacagccaaacagttgggaaccattgcagtcaaggaattgcttcgtcggatt
ccggaggcaaaaaaggcagacggagttttgcttgcacaggtaatccaggcgggagaagga
caaaatccagcacgaaaagttgccgtagaagcgggagtagatctctcggtacctgcgatt
acgcttaataatgtttgtcttgccggattggcttccgttgcggatgctgctcgaaggatt
gcattacaggaagggcagttatacatagtcgggggctatgattcgatgacaaacgctccg
catatagctaacttacgaaaaagcgtcactcttggaaaagcagagttcacggacacatta
atcaatgacgggctgtggtgctctctttcaaacgaattaatgggtgtattgactgacaag
aaaaacaaagaactcggaatcactcgtaaggaacaggatgaatttgcttgcctttcacag
caaagggctttttcagcattaaaagaaagccgtttgcaggaagaaattactcctgtatac
gtgaatgaagaattggtaaaggaagatgaaggcattcgccctaacaccacgattgaagga
ctagctaaacttcgtcctgtatttacagaagatggaacgattactgccggaaacgcatcg
caaatgtcagatggagcgagtgccggaattgtcgcaagtgagacgctcgctgaaaaactt
ggatacacaccgcttgcaagaattatcggttgggcagatattgccggtccggatacaagc
ctccatttaaaaccggctcaagcaattgaaaaagtcctcgaaaagacgggactttcggtc
aatgatatagatttgtttgaaataaacgaagcatttgccagtgtggcaattgccagttgc
aaaaaactgcggattccatttgaaaaagtgaatgttaacggcggagcgatcgccattggc
catccattaggaggcaccggtttccggttgctcttaactcttgttcatgaattaagacgg
cgcggcggcggaaaaggaattgcggcactttgcggcgggggcggccagggaacagcagtc
ttagtagaagttccggagaggtggtaa

DBGET integrated database retrieval system