KEGG   Bacillus methanolicus: BMMGA3_01865Help
Entry
BMMGA3_01865      CDS       T03209                                 

Gene name
phoD
Definition
(GenBank) Alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00790  Folate biosynthesis
bmet01100  Metabolic pathways
bmet02020  Two-component system
Module
bmet_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMMGA3_01865 (phoD)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMMGA3_01865 (phoD)
Enzymes [BR:bmet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BMMGA3_01865 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: AIE58843
UniProt: A0A068LPK2
Position
351781..353532
Genome map
AA seq 583 aa AA seqDB search
MMVNERPLEEWIKNLSEASLQKNIDRRSFLHIAGKIAGLSLGFVIAQSIGGFEVNAAPRF
RDYPFTLGVASGDPLSDSVVLWTRLAPDPLGGGGMSSQAVPVKWEVAIDEYFRKIVQRGT
ELAVPELGHSIHVEVHGLKPNFEYFYRFKSGNEVSPVGKTKTLPEIGTSVSSLAFAFASC
QQYEHGYYTAYKHMSKEDLDLVFHLGDYIYEYGPNEYVSNTGNVRTHNSPEIITLEDYRN
RYAQYRSDVNLKAAHAAFPWVVTWDDHEVENNYANVIPEKGQSVEAFIKRRAAAYQAYYE
HMPLRQSSLPHGGDMQLYRNFSYGDLASFFVLDTRQYRDDQANGDGSKPHTPESLDPNRT
LLGAEQEEWLLGNLGNSSSQWNVLAQQVFFSQRNYGTSTSPKFSMDSWDGYPAARQRITD
FVASNNINNLIVLTGDVHASWASNLMTDYNDPNSKIIGAEFVGTSITSGGNGADKRADTD
RILGLNPQIKFFNDYRGYVRCRVTPEYWQADYRVLPFVTKPGADISTRASFTYEKDQTGL
KEISSTIVPEGVRISNEVEEDRNRAHGRAHERQMQRKLKNFTN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgatggttaatgagcggcctttggaagaatggattaagaatctcagtgaggcgagtttg
caaaagaatattgaccgccgcagttttcttcatattgccggtaaaattgcggggctttca
cttggttttgtcatcgcacagtctatagggggatttgaggtcaatgctgccccaagattt
agagactacccttttacacttggtgttgcttcaggtgatccgctatcagacagtgtggta
ctatggacaagattggctccagatccgttgggcggcggaggaatgtcttcccaggcggta
ccagttaaatgggaggttgctatagatgaatatttccgcaaaattgtccagcgcggcact
gaattagcagtgcctgagctcggtcattctattcatgtggaagtacacggactaaaacca
aactttgaatacttttaccggttcaaaagcggaaatgaagtgagccccgtcggaaaaaca
aaaacactcccagaaattggaacaagcgtttccagtctagctttcgcgtttgcatcctgt
cagcagtatgaacatggatactatactgcatataagcatatgtccaaagaagatcttgat
ctcgtcttccacctaggcgattacatatatgaatatggaccgaatgaatatgtttcaaac
acaggaaatgtccgaacacacaatagtccagaaatcattacgcttgaagactaccgaaac
cgctatgcccaatatcgttcagatgtaaatctgaaagccgcccatgctgccttcccgtgg
gttgtgacatgggatgatcatgaagtcgaaaacaactatgcgaatgtcattcctgaaaaa
gggcagtcggttgaggcatttatcaaacgtcgagctgctgcgtaccaggcttattatgag
cacatgccgctccgccaatcatctttgccacacggcggtgatatgcaattatataggaat
ttctcttacggtgatttagcatctttttttgttcttgatacacgtcaataccgtgatgac
caagcaaatggcgatggaagcaaaccgcatacgccagaatctttggatccgaatcgcacc
cttttgggagcagaacaggaagagtggcttttaggcaatcttggcaattcatcgtcacaa
tggaatgtgctggcacagcaagttttcttttcacagcggaattatggaacaagcacatcc
ccaaaatttagtatggattcttgggacggttacccggcagcacgtcagcgtattactgat
ttcgttgcaagcaacaatattaataatttgatcgtcttgacaggggatgtccacgcaagc
tgggcatcaaacctgatgacggattataatgatccaaattctaaaattatcggtgctgaa
tttgtcggaacttccattacatccggagggaacggagctgataagagggcagacaccgat
cgtattttagggttgaacccgcaaattaaattctttaacgactatcggggctatgtccgc
tgcagggtcactccagaatactggcaagctgattaccgtgtgctcccatttgttacaaaa
ccgggtgccgatatttcaacaagagcgtcctttacttatgaaaaagatcaaacgggactg
aaagaaatatcgtctacaattgttccggaaggtgttcgaatttcaaatgaagtcgaagaa
gaccgcaatcgggcccatggccgcgcccatgaaagacaaatgcaaaggaaattgaaaaac
ttcacgaattaa

DBGET integrated database retrieval system