KEGG   Bacillus methanolicus: BMMGA3_02585Help
Entry
BMMGA3_02585      CDS       T03209                                 

Gene name
sirB1
Definition
(GenBank) Sirohydrochlorin ferrochelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00860  Porphyrin and chlorophyll metabolism
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMMGA3_02585 (sirB1)
Enzymes [BR:bmet01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BMMGA3_02585 (sirB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK Ferrochelatase
Motif
Other DBs
NCBI-ProteinID: AIE58981
UniProt: A0A068LML3
Position
505385..506146
Genome map
AA seq 253 aa AA seqDB search
MEAILYICHGSRVKKACEQAIEFIKKCMAQNPVSIQEYCFLELAAPTIEEAYEKCVQRGA
TKIVVLPVLLLTAVHAKEDIPNELERIRKRFPNVEMVYGRPIGVHHHMIDILIERLLETR
EELSEDSMVLLIGRGSSDPDVKRDLTEIAQLLKRKAGLKRVDTCYLTAAKPGLEEALFTA
KQSSYRKIFIIPYLLFTGILMNTIKKTIKAGFADGEKEYVLCNYLGYHPLIGNILRERYN
ELLGGSDRVSHYA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaagctattctctatatctgtcatggaagcagggtgaaaaaagcgtgtgagcaggcc
attgaatttataaaaaaatgcatggcccaaaaccctgtttctattcaagagtattgcttt
cttgaattggcggctcccacgatcgaagaagcatatgaaaagtgcgtccaaagaggcgct
actaagattgttgttcttcctgttttgctcttgactgctgtccatgcaaaagaagatata
ccaaacgaacttgaacgaatccgaaaacgattcccgaacgtggaaatggtatatgggaga
ccaattggcgtccaccaccatatgattgatatcttgattgaacgtctccttgaaacaagg
gaagagcttagtgaagattccatggttctcttaatcggtagagggagcagcgacccggac
gtaaagcgtgacttaaccgaaatcgcacagctgctaaaaaggaaagcaggattaaaaagg
gttgacacatgttatttaacagcagcaaaacctggtttggaagaggctctttttactgca
aagcagagcagctataggaaaatatttatcatcccatatctgctttttacaggaattttg
atgaataccattaaaaaaaccattaaggcaggcttcgctgatggagaaaaggaatatgta
ttatgcaattatcttggataccacccgttgattggaaacatattgcgggaacgttataac
gaacttttgggaggcagcgaccgtgtatcccattatgcttga

DBGET integrated database retrieval system