KEGG   Bacillus methanolicus: BMMGA3_02590Help
Entry
BMMGA3_02590      CDS       T03209                                 

Definition
(GenBank) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00860  Porphyrin and chlorophyll metabolism
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMMGA3_02590
Enzymes [BR:bmet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BMMGA3_02590
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BMMGA3_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M TetR_C_27 PIN_3 LSDAT_prok TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIE58982
UniProt: I3E352
Position
506127..506741
Genome map
AA seq 204 aa AA seqDB search
MYPIMLDMTNKLCVIIGGGKIAYRKVVPLLKAGANIHIVSPEICDEINKLWTEQKVKVFL
KEVEKADYEHAFMIIAATNSKEINEQIYKNTTENQLVNIVSDQEMGNFHIPASAVRGRLV
ISVSTGGASPALAKKIRNDLLDQFDESYEGYLDFLWEVRKKIKNSRLSETEKSNLLLKLA
EEKFKDSEKERNRFMTWMQEFLVD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgtatcccattatgcttgatatgaccaataagctatgtgttatcattggcggtgggaaa
attgcttatcgaaaagtggttccattactcaaagcaggagcaaacatccatatcgtaagt
ccggaaatatgtgacgagataaataagctctggactgaacagaaggtaaaagtgttttta
aaagaagtagaaaaggctgactatgaacatgcttttatgatcattgcggctacaaattcg
aaagaaataaatgaacaaatttataaaaatacaacggaaaatcagctggttaatatcgtt
agcgatcaagaaatggggaatttccacatacctgcttccgcagtaagaggacgattggtg
ataagtgtttcaactggcggggcaagtccggctcttgcgaaaaaaataagaaatgattta
cttgatcaatttgatgaatcctatgaaggttatcttgatttcttgtgggaagtccgcaag
aaaatcaagaacagccgtttatcagagacggagaaatcaaatctgttactcaaattggca
gaggaaaaatttaaagattccgagaaagaaagaaacagatttatgacttggatgcaagaa
tttttagttgattaa

DBGET integrated database retrieval system