KEGG   Bacillus methanolicus: BMMGA3_08610Help
Entry
BMMGA3_08610      CDS       T03209                                 

Gene name
yitJ
Definition
(GenBank) Bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00270  Cysteine and methionine metabolism
bmet00670  One carbon pool by folate
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01120  Microbial metabolism in diverse environments
bmet01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMMGA3_08610 (yitJ)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BMMGA3_08610 (yitJ)
Enzymes [BR:bmet01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BMMGA3_08610 (yitJ)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     BMMGA3_08610 (yitJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-methyl_trans MTHFR
Motif
Other DBs
NCBI-ProteinID: AIE60124
UniProt: I3E8N4
Position
1703209..1705074
Genome map
AA seq 621 aa AA seqDB search
MSFLEKLKNQILIADGAMGTLLYSYGTDCCFEELNLSQAEQITNIHRAYIDAGADVIQTN
TYAANYLKLKRYGLEDFVKEINSAAVKNAKKAAQNRAYILGTIGGNRGIKPNTIPIEEIK
RSFREQLYCLLLEGVDGILLETYYDLQELETVLQIARKETDLPIIAQVSLQEVGIMQDRT
PITEAFNRLEGLGADVIGLNCRLGPHHMLVTLEEVPLPKSAYLSAYPNASLPAYTDGKFH
YEGDADYFRKSARSFREQGVRLLGGCCGTTPEHIRAFAAELHDTPPVTEKAVKQKPKKII
IQPAEAIREYPPLQDIVKERKSIIVELDPPKKLDTTKFFQGAKALKETGIDAITLADNSL
ASPRISNSALGYLTKTQIGMRSIIHITCRDRNIIGLQSHLMGLHTLGLHDILAVTGDPAR
VGDFPGASSVYDVSSFELIQMIKQLNEGLSISGKELGQKAAFSVAAAFNPNVRSLEKAVN
RLEKKMKFGADYFISQPIFSEEKLVEVYEATKHIKAPIYIGIMPLISSKNAEFLHHEVPG
IKITDAIRDRMAKFKDNPHQAILEGLDIAKSLIDAALDLFNGIYLITPFLRYELTVELAE
YARSQSANLVRRNNHVQSIIH
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcctggaaaaattaaaaaatcaaattttaattgccgacggtgcgatgggaact
cttctttattcctatggaacagactgctgtttcgaggagttaaacctttcccaggccgag
caaatcacaaatattcaccgtgcttatattgatgccggcgctgatgtgattcaaacaaac
acttatgcagccaattatttgaagctgaagcgatacggacttgaagattttgtaaaagaa
atcaacagtgctgctgtaaaaaatgcaaaaaaagcagcgcaaaaccgggcttacatactg
ggaacaattggaggcaatcgcggcataaaaccaaatacgattccaatagaagaaattaaa
agaagctttcgcgaacaattatattgccttcttttagaaggagtcgatggaattttacta
gaaacctattatgatcttcaagaattagaaacagttttgcaaattgctagaaaagaaacg
gacctgccgattattgcgcaagtttccctgcaagaggttggaataatgcaggaccggaca
ccgataacagaagcgttcaatcgattagagggcctgggagcagatgtcatcggacttaat
tgccgtcttggccctcatcatatgctggtaacacttgaagaagtcccccttccaaagagt
gcttatttatcagcttatccaaacgccagtcttcctgcatataccgacggcaaatttcat
tatgaaggggatgcagattactttagaaagtcggcacgctctttcagagaacaaggagtc
agactgcttggaggatgctgcggaactacgcctgaacatatacgagcctttgcagcggag
cttcacgatactccgccagtaacggaaaaagcagtgaaacagaaaccgaagaaaatcata
atacagccagcagaggctataagagaatacccgcctctgcaggatatcgtaaaggagaga
aaatccattatcgttgaactggatccgcccaaaaaattggatacgacaaaattttttcaa
ggggctaaggcactgaaggaaacggggatagatgccattacattggctgacaactctctt
gcctccccccgcatctcaaattctgctttaggatatttgacaaaaacacaaatcggtatg
cgttcgatcattcatataacttgccgtgacaggaatattatcggtttgcagtctcatcta
atgggactacatacattgggtttgcatgacatcctcgctgtaaccggagatccggcacgg
gtcggtgatttcccgggagcatcgtccgtttatgatgtgtcttcttttgaattaatccaa
atgattaaacaattaaatgaaggattatcaatttccgggaaggaacttggccagaaagca
gctttttcagttgctgcagcttttaacccgaacgttcgatctttggaaaaagcagtaaac
cgccttgaaaagaaaatgaagtttggagcagattattttatttctcagccgattttttca
gaagaaaaactcgtagaagtatatgaagctacgaaacatattaaggcaccaatttatatt
ggaattatgccgttaataagcagcaaaaatgctgaattcctgcatcatgaagtgcccggt
ataaaaataactgatgccattagagacaggatggcaaaattcaaggataatcctcatcaa
gccattcttgaaggccttgacattgcaaaatcgttaattgatgcagcactggatcttttt
aacggaatataccttattaccccatttttgcgatatgagctaactgtggagttagcggaa
tatgcccgaagtcaaagtgcgaatttagttaggaggaacaaccatgtccaaagcatcatt
cactga

DBGET integrated database retrieval system