KEGG   Bacillus methanolicus: BMMGA3_14240Help
Entry
BMMGA3_14240      CDS       T03209                                 

Gene name
yutF
Definition
(GenBank) putative hydrolase YutF
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00627  Aminobenzoate degradation
bmet01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMMGA3_14240 (yutF)
Enzymes [BR:bmet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BMMGA3_14240 (yutF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AIE61206
UniProt: I3DUJ3
Position
complement(2815876..2816643)
Genome map
AA seq 255 aa AA seqDB search
MKSYKGYLIDLDGTMYRGTELIKEAADFVKKLRDKKIPYLFVTNNSTRTPAQVAKKLRDF
GIPAEENLVFTTSQATANYIYELKKDASVYVIGEEGIRTAIEEKGLQFGGEHADFVVVGL
DRSISYEKLAVACLAVRNGATFISTNGDIALVTERGLLPGNGAITSVIAVSTQTQPIFIG
KPESIIVEQALRVLGINKEDTLMVGDNYDTDILAGMNAGMDTLLVHTGVTTKEHLKRYEK
QPTYVVDSLDQWEIL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtcttataaaggatatttaattgatcttgacggaacaatgtaccgcggcacagaa
ctcattaaggaagcagccgattttgtgaaaaaattgcgcgataaaaagattccctattta
tttgttacaaataattcaacaagaacacctgcgcaagtggcaaaaaaactgcgcgatttt
ggtataccggctgaagaaaatcttgtttttacaacaagccaagcaacagcaaattatatt
tatgaattgaaaaaagatgcttccgtgtacgtgatcggtgaagaagggatccgaacggcg
attgaggaaaaaggactgcaatttgggggggaacatgcggattttgtcgtagtaggactg
gatcgttcgatcagttatgagaaattagcggtggcttgtttggcggtaagaaatggagca
accttcatttctacaaatggagatattgcacttgtgactgaaagaggcttgctgcctggg
aatggagcaattacatcggtcattgctgtttcgacgcaaacacaaccgatatttatcgga
aagcctgagtcgattattgtggaacaggctttaagagtgcttggaattaataaagaggat
actttaatggtcggggataattatgatacagacatactagcaggaatgaatgctgggatg
gatacattgcttgtgcatacaggtgttacaacaaaagagcatttaaaacgctatgaaaaa
caaccaacatatgtcgttgattctctagaccaatgggaaattttataa

DBGET integrated database retrieval system