KEGG   Bacillus methanolicus: BMMGA3_16180Help
Entry
BMMGA3_16180      CDS       T03209                                 

Gene name
mmgA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmet  Bacillus methanolicus
Pathway
bmet00071  Fatty acid degradation
bmet00072  Synthesis and degradation of ketone bodies
bmet00280  Valine, leucine and isoleucine degradation
bmet00310  Lysine degradation
bmet00362  Benzoate degradation
bmet00380  Tryptophan metabolism
bmet00620  Pyruvate metabolism
bmet00630  Glyoxylate and dicarboxylate metabolism
bmet00640  Propanoate metabolism
bmet00650  Butanoate metabolism
bmet00900  Terpenoid backbone biosynthesis
bmet01100  Metabolic pathways
bmet01110  Biosynthesis of secondary metabolites
bmet01120  Microbial metabolism in diverse environments
bmet01130  Biosynthesis of antibiotics
bmet01200  Carbon metabolism
bmet01212  Fatty acid metabolism
bmet02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMMGA3_16180 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMMGA3_16180 (mmgA)
   00640 Propanoate metabolism
    BMMGA3_16180 (mmgA)
   00650 Butanoate metabolism
    BMMGA3_16180 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMMGA3_16180 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BMMGA3_16180 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMMGA3_16180 (mmgA)
   00310 Lysine degradation
    BMMGA3_16180 (mmgA)
   00380 Tryptophan metabolism
    BMMGA3_16180 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMMGA3_16180 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMMGA3_16180 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMMGA3_16180 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmet04147]
    BMMGA3_16180 (mmgA)
Enzymes [BR:bmet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMMGA3_16180 (mmgA)
Exosome [BR:bmet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMMGA3_16180 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AIE61589
UniProt: I3EBN7
Position
complement(3227690..3228877)
Genome map
AA seq 395 aa AA seqDB search
MGKTVILSGVRTPFGKLGGSLSSLQASELGGIAIKEALKRANVNPEEVDEVILGSVLQGG
QGQIPSRQAARYAGIPWEVKTETINKVCASGMRSVTLADQIIRAGDEELIVAGGMESMSN
APYLLPNARWGLRMGDSSVKDLMIHDGLSCSFTGVHMGTYGNSTAKEMEISREEQDQWAY
RSHERAIAAIEAGKLAEEIVPVEIPQRKGEPIIVQNDESPRKDTSLEKLAKLKPVFNSDG
TITAGNAPGVNDGAAALVLMSEERAEREGRTPAAYILGHAAVAVEAKDFPKTPGLVIQQL
LKKTGKLLEDIDLFEINEAFAAVALASGKIAKVDPEKVNVNGGAIALGHPIGASGARIII
TLMHELKRRGGGIGIAAICSGGGQGDAVMIEVPKQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaccgtcattttaagcggagtcaggacaccttttgggaaattaggggggagc
ttgagcagcctgcaagcatctgaacttgggggaattgccataaaagaagcgctgaaacgg
gcaaacgtgaacccggaagaggtagatgaagtcattttgggaagcgttttacaaggaggg
caggggcagattccatcgagacaggcagcccgttatgcaggaattccatgggaagtaaaa
acggagacaattaataaggtttgtgcatcgggaatgaggagtgttacccttgcggaccag
attattcgcgccggtgatgaagaactgattgttgccggaggcatggaatcgatgagcaac
gccccttatctattgccaaatgctcgctgggggcttaggatgggtgactcttcggtgaag
gatctgatgattcatgacggcctctcctgcagttttacaggcgttcatatgggaacgtac
ggaaacagcacggcaaaagaaatggaaatcagccgcgaggaacaggatcaatgggcttac
agaagccatgagcgcgcaattgccgcaatcgaagccggcaagctggccgaggaaattgtt
ccggtagaaattcctcaaagaaaaggcgaacctattattgtgcaaaacgatgagtctcca
cgaaaggatacctcattggaaaaattggcaaagctcaagcctgtattcaactctgacgga
acgattacagctgggaatgcacccggagtcaatgacggggcggcagctttagttttgatg
agcgaagaaagggccgagcgtgaaggcagaacaccggcagcttatattttgggacatgca
gccgttgcggtggaagcgaaagattttccgaaaacccctggtcttgtcattcaacaattg
ctaaagaaaaccggaaaattgctagaggatattgatttatttgaaattaatgaagcgttt
gcagctgttgctcttgcaagtggaaaaattgcaaaggtcgatcctgaaaaagtaaatgta
aacggcggagcaattgcactcggccatccgattggcgccagcggagcccgcatcattatc
acattaatgcatgagttgaaacgccgcggcggaggaattggaatcgcagccatttgttcg
ggcggcggacaaggtgacgctgtgatgattgaagttccgaaacagtaa

DBGET integrated database retrieval system