KEGG   Brucella abortus 2308: BAB1_1406Help
Entry
BAB1_1406         CDS       T00304                                 

Definition
(GenBank) ATP/GTP-binding site motif A (P-loop)
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
bmf  Brucella abortus 2308
Brite
KEGG Orthology (KO) [BR:bmf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BAB1_1406
Enzymes [BR:bmf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BAB1_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 Viral_helicase1 PIF1 AAA_16 AAA_33 UvrD_C ATPase_2 TsaE AAA_22 AAA_28 AAA TniB AAA_18 AAA_11 SH3_13 AAA_5 NB-ARC AAA_13 PhoH
Motif
Other DBs
NCBI-ProteinID: CAJ11362
UniProt: Q2YQM5
Position
I:complement(1356371..1357492)
Genome map
AA seq 373 aa AA seqDB search
MQFSPEQDQALKAVGQWLKAGRSPIFRLFGYAGTGKTTLARYFAEHVDGEVQFAAFTGKA
AQVLRSKGASNARTLHSLIYRPRGEEAIEDETTGKTSIAPTFSLNRQSPVAKAAMIVVDE
CSMVDEALGRDLMSFGTPILVLGDPGQLPPISGGGFFTEHEPDYLLTEIHRQARDNPIIR
MALDVREGRELSYGDYGAAKVIGKSEVNQDIVLAADQVLVGTNRTRRRYNQRLRELKGFT
ADYPQAGDKLVCLRNDPTKGLLNGSLWKVMTSSKETVKPGINLLVSPEDEDRGVAKIKLL
KAQFEDPDTEIPWQTKKRFDDFDYGYALTVHKAQGSQWDQVVLFDESFAFRDTRERWLYT
AITRAAERLIIVK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcagttttcacccgaacaggatcaggcgctgaaagcggtcggccaatggctcaaggcc
gggcgcagccccatcttcaggctctttggctatgccggcacgggcaagacgacgcttgcg
cgctattttgccgagcatgtggatggtgaggtgcagtttgcagccttcaccggcaaggcg
gcgcaggttctccgttccaagggcgccagcaatgcccgcacgcttcattccctgatttat
cgcccgcgcggtgaagaggcgattgaggacgagacgacaggcaagacatccattgcgcca
accttttcgctcaaccggcaaagcccggttgcgaaagccgccatgatcgtggtcgatgaa
tgttcgatggtggatgaggcgctgggacgggacctgatgagtttcggcacgccaattctc
gttctgggggatccgggccaattgccgccgatttccggcggcgggttcttcaccgagcat
gagccggattatctcctgaccgaaattcatcgtcaggcacgcgacaatccaatcatccgc
atggcgctggatgtgcgcgaaggccgggaactgtcctatggcgattatggcgcggcaaag
gtgatcggcaaaagcgaggtcaatcaggatatcgttctggccgcagatcaggtgcttgtg
ggcaccaaccgcaccaggcggcgctataaccagcgcctgcgggagctgaaaggttttacg
gccgattatccgcaggcgggtgataagctcgtctgcctgcgcaacgatccgaccaagggg
ctgctcaacggctcgctctggaaggtgatgacttcttccaaggaaaccgtgaagcccggc
atcaatcttctggtctcgccggaggatgaggatcgcggcgttgccaagatcaagcttctc
aaggcgcagttcgaggacccggacaccgaaattccgtggcagaccaagaaacgttttgat
gattttgattatggctatgcgctgaccgtccataaggcgcagggttcgcaatgggatcag
gtcgttctgttcgacgaaagcttcgcctttcgcgatacgcgtgaacgctggctctatacg
gccattacgcgcgcggcagaacgcctcatcatcgtgaagtaa

DBGET integrated database retrieval system