KEGG   Brucella abortus 2308: BAB1_1448Help
Entry
BAB1_1448         CDS       T00304                                 

Gene name
murB
Definition
(GenBank) Helix-turn-helix, AraC type:UDP-N-acetylenolpyruvoylglucosamine reductase:FAD linked oxidase, N-terminal
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00520  Amino sugar and nucleotide sugar metabolism
bmf00550  Peptidoglycan biosynthesis
bmf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAB1_1448 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAB1_1448 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmf01011]
    BAB1_1448 (murB)
Enzymes [BR:bmf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     BAB1_1448 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:bmf01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   BAB1_1448 (murB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MurB_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: CAJ11404
UniProt: Q2YLY7
Position
I:complement(1400880..1401848)
Genome map
AA seq 322 aa AA seqDB search
MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV
PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA
LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA
YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNSEGTS
AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW
EIKRLGLFREGEQIEEFLGKIV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaagcggcgaggcgcttctaaagaagctcgacggcaggctgtctggcttgcgc
gggcggcttacgcccgatacgggcatggacaagatcacctggtttcgcgcaggcgggccg
gcgcaggttctgttccagccgtccgacgaggaagacctctccgcatttctgaaagccgtg
ccggaagaaataccacttctcgtggtggggatcggctccaatcttctggtgcgtgacggc
ggtgtgccgggcttcgtggtccggctttcggccaagggctttggtgaggtcgaacaggtt
tgcgatacgcagttgcgggcaggggcggcagcgcccgacaagcgcgtggccgcagcagcc
ctcgaagcgggcctggcgggctttcatttctatcatggcattcccggcgggatcggtgga
gcactgcgcatgaatgcgggcgcaaacggcgtggaaacgcgcgagcgcgtggtggaagtg
cgcgcgcttgaccgcaagggggaggtgcatgtgctttcaaatgccgatatgggctatgcc
tatcgccattcctcggcgtcgcccgatctgattttcacctcggtcctgtttgaaggcgtg
ccgggtgagcgcgatgacatccgccgcgcgatggacgaagtgcagcatcatcgcgaaacg
gtgcagccggtgcgcgagaagaccggcggctcgaccttcaagaactcggaagggacgtcc
gcgtggaaggaaatcgacaaggcgggatgccgtggcctgcgtgtcggcggtgcgcagatg
tcggaaatgcactgcaacttcatgatcaatacgggcaatgccacggggcatgatctggag
actttgggcgaaacggttcgcgcaagggttttcgagaattcggggattcgcctgcactgg
gaaatcaaacgtctcggtttgttccgcgaaggggagcagatcgaggagtttcttggaaaa
atagtataa

DBGET integrated database retrieval system