KEGG   Brucella abortus 2308: BAB1_1783Help
Entry
BAB1_1783         CDS       T00304                                 

Gene name
phbA-1
Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00071  Fatty acid degradation
bmf00072  Synthesis and degradation of ketone bodies
bmf00280  Valine, leucine and isoleucine degradation
bmf00310  Lysine degradation
bmf00362  Benzoate degradation
bmf00380  Tryptophan metabolism
bmf00620  Pyruvate metabolism
bmf00630  Glyoxylate and dicarboxylate metabolism
bmf00640  Propanoate metabolism
bmf00650  Butanoate metabolism
bmf00900  Terpenoid backbone biosynthesis
bmf01100  Metabolic pathways
bmf01110  Biosynthesis of secondary metabolites
bmf01120  Microbial metabolism in diverse environments
bmf01130  Biosynthesis of antibiotics
bmf01200  Carbon metabolism
bmf01212  Fatty acid metabolism
bmf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAB1_1783 (phbA-1)
   00630 Glyoxylate and dicarboxylate metabolism
    BAB1_1783 (phbA-1)
   00640 Propanoate metabolism
    BAB1_1783 (phbA-1)
   00650 Butanoate metabolism
    BAB1_1783 (phbA-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAB1_1783 (phbA-1)
   00072 Synthesis and degradation of ketone bodies
    BAB1_1783 (phbA-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAB1_1783 (phbA-1)
   00310 Lysine degradation
    BAB1_1783 (phbA-1)
   00380 Tryptophan metabolism
    BAB1_1783 (phbA-1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAB1_1783 (phbA-1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAB1_1783 (phbA-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAB1_1783 (phbA-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmf04147]
    BAB1_1783 (phbA-1)
Enzymes [BR:bmf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAB1_1783 (phbA-1)
Exosome [BR:bmf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAB1_1783 (phbA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAJ11739
UniProt: Q2YLD5
Position
I:complement(1716473..1717657)
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGFPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGGVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVDPSIMGTGPIPATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggtttcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaaggggggtgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttgatccgtcgatcatgggaaccgggccgattcccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system