KEGG   Brucella abortus 2308: BAB1_2112Help
Entry
BAB1_2112         CDS       T00304                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase:Pyridoxal-5'-phosphate-dependent enzyme, beta family:Tryptophan s...
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00260  Glycine, serine and threonine metabolism
bmf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmf01100  Metabolic pathways
bmf01110  Biosynthesis of secondary metabolites
bmf01130  Biosynthesis of antibiotics
bmf01230  Biosynthesis of amino acids
Module
bmf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAB1_2112
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAB1_2112
Enzymes [BR:bmf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAB1_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Flavodoxin_1
Motif
Other DBs
NCBI-ProteinID: CAJ12068
UniProt: Q2YQW5
Position
I:complement(2048749..2049969)
Genome map
AA seq 406 aa AA seqDB search
MNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYETARNDPEFKAELNALS
TFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCLGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCIVYVGATDVERQKPNVFRMKLLGAEVKPVSAGNGTLKD
AMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEARQQILEQEGRLPDVIV
AAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMSAGRPGVLHGNRTYLLQ
NADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEALDAFQLCTRTEGIIPA
LESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGMDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaagccggttgcacccaattcctacaagacgggccctgacgaagagggcatgttc
ggcatattcggtggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcag
caggcttatgaaacggcgaggaatgaccccgaattcaaggcggagttgaacgccctttcc
accttttatgccggccgtccttccaagctctattatgccgaaggcctgagcaaacatctg
ggtggcgctaaaatctacttcaagcgcgaagacctgaaccataccggcagccacaagatc
aacaattgccttggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgca
gaaacgggcgccggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctg
ccctgtatcgtctatgtgggcgcaaccgacgtggagcgccagaagcccaatgttttccgc
atgaagctgctcggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagac
gcgatgaacgaagccctgcgtgactgggttacgaatgtcgaggatacctattacctgatc
ggcacggctgccggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatc
ggcaccgaagcgcgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtg
gcagcggtcggcggcggctccaacgccattggcctgttccatccgttcctcgacgacgcc
tcggtgaagatcgtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgc
gcttcgatgagcgcaggccgccccggcgttctgcatggcaaccgcacctatctcctccag
aacgcggatggccaaattctggaaggccattcggtttccgctggtctcgactatccgggc
gtcgggcccgagcattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctc
gacaatgaggcgctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcg
ctcgaatccgcccatgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggac
aaggtgatgatcgtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaag
cttctcggcatggatatctga

DBGET integrated database retrieval system