KEGG   Brucella abortus 2308: BAB2_1010Help
Entry
BAB2_1010         CDS       T00304                                 

Gene name
glk
Definition
(GenBank) Glucokinase:Inorganic pyrophosphatase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00010  Glycolysis / Gluconeogenesis
bmf00052  Galactose metabolism
bmf00500  Starch and sucrose metabolism
bmf00520  Amino sugar and nucleotide sugar metabolism
bmf00521  Streptomycin biosynthesis
bmf01100  Metabolic pathways
bmf01110  Biosynthesis of secondary metabolites
bmf01120  Microbial metabolism in diverse environments
bmf01130  Biosynthesis of antibiotics
bmf01200  Carbon metabolism
Module
bmf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAB2_1010 (glk)
   00052 Galactose metabolism
    BAB2_1010 (glk)
   00500 Starch and sucrose metabolism
    BAB2_1010 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BAB2_1010 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAB2_1010 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BAB2_1010 (glk)
Enzymes [BR:bmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BAB2_1010 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CAJ13176
UniProt: Q2YJN9
Position
II:983020..984051
Genome map
AA seq 343 aa AA seqDB search
MQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAIQHAIL
DQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQALAVV
SLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLFRTRHAWVPVPGEGGHIDIGPRTER
DYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLDGSNPQ
AAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRATFEDKAPHKA
IMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgattatcgacgccgaacagagtttcaagtttccggttctcgtcggcgatatc
ggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcggagccgaaggagttt
cccgtgctccagacggcggattatgccacaatagacgaagcgatccagcacgccattctg
gatcagacggccatccagccgcgctctgtcattctggccgtggcaggcccggtggacggc
gacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaaaagatgatcgctgat
ctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcaggcccttgccgtggtt
tcgctggaaggccaccatatggaacagatcggcggcaaaccggaggaggctgttgccacc
cgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctgtttcgcacacgtcat
gcatgggttccggttcccggtgaaggcggtcatatcgatatcggtccacgcaccgaacgc
gactaccagattttcccgcatatcgaacgcatcgaagggcgtgtcaccggcgagcaaatt
cttagcgggcggggcctgcgcaacctctatctgggcatctgcgccgccgacaagatcacg
cccacccttgagacgccagtagacattacatccgccggactggacggcagcaatccacaa
gccgcagaaacgcttgacctcttcgccacctatctggggcggcttgcgggcgaccttgcg
ctcattttcatggcgcatggcggcgtttatctttcgggtggcatcccggtgcgcatcctt
tccgccctcaaggccggttcgttccgcgcaaccttcgaggacaaggccccgcacaaggcc
atcatgcgcgacataccggtccgcgttatcacatatcaactggcggccttaaccgggctt
tccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgagggccgccgctggcgc
atgcgccgctag

DBGET integrated database retrieval system